DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and OTOG

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	NP_001264198.1	Gene:	OTOG / 340990	HGNCID:	8516	Length:	2925	Species:	Homo sapiens

Alignment Length:	92	Identity:	23/92 - (25%)
Similarity:	37/92 - (40%)	Gaps:	6/92 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    49 GDDCQVTPVIHVLQYPGC-VPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVS 112
            |..|:...:...::...| ...|:...:|.|||.| ..:....|....|.|.||:|.|.:..:|.
Human  2837 GRSCKKVTIRMTIRKNECRSSTPVNLVSCDGRCPS-ASIYNYNINTYARFCKCCREVGLQRRSVQ 2900

  Fly   113 LFCPKVKPGERKFKKVLTKAPLECMCR 139
            |||..    ...:.....:.|.:|.|:
Human  2901 LFCAT----NATWVPYTVQEPTDCACQ 2923

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	21/88 (24%)
OTOG	NP_001264198.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	39..69
		VWD	152..302	CDD:278521
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	316..335
		C8	348..412	CDD:285899
		TIL	426..474	CDD:280072
		VWC_out	476..>511	CDD:214565
		VWD	503..668	CDD:214566
		C8	711..770	CDD:285899
		TIL	780..844	CDD:280072
		TIL	884..946	CDD:280072
		VWD	977..1131	CDD:214566
		C8	1166..1240	CDD:214843
		Fascin	<1305..>1370	CDD:304938
		DUF4696	1473..1987	CDD:292395
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1476..1540
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1636..1679
		E_Pc_C	<1639..1720	CDD:284226
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1693..1715
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1737..1788
		HrpB2	1953..>2040	CDD:305050
		VWD	2112..2266	CDD:278521
		C8	2304..2370	CDD:214843
		TIL	2373..2434	CDD:280072
		NADB_Rossmann	<2676..2736	CDD:304358
		CT	2842..2924	CDD:214482	21/87 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900