DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and Kcp

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	XP_011239372.1	Gene:	Kcp / 333088	MGIID:	2141640	Length:	2120	Species:	Mus musculus

Alignment Length:	139	Identity:	30/139 - (21%)
Similarity:	48/139 - (34%)	Gaps:	41/139 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    52 CQVTPVIHVLQYPG-CVPK----------------------PIPSFAC---VGRCASYIQVSGSK 90
            |...|.:|.:..|| |.|:                      |..|..|   :..||. :|...:.
Mouse   968 CPSLPCLHQVTEPGTCCPRCTGCLARGEEHPEGSSWVPADSPCSSCMCHKGIITCAQ-VQCVSAC 1031

  Fly    91 IWQMERSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGI--IPQE 153
            ||..|....||.:           |...:.|.||::...:..|....|..|...|::.:  .|::
Mouse  1032 IWPQEGPSDCCPQ-----------CSGCEHGGRKYEPGESFQPGADPCEVCICKEQADMPTAPKD 1085

  Fly   154 IAGYSDEGP 162
            : |.:|..|
Mouse  1086 M-GVADRYP 1093

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	23/111 (21%)
Kcp	XP_011239372.1	VWC	166..220	CDD:278520
		VWC	224..280	CDD:327433
		VWC	285..341	CDD:327433
		VWC	344..399	CDD:327433
		VWC	458..514	CDD:278520
		VWC	517..573	CDD:327433
		VWC	634..690	CDD:327433
		VWC	<717..753	CDD:327433
		VWC	931..987	CDD:327433	7/18 (39%)
		VWC	<1173..1214	CDD:214564
		VWC	1221..1278	CDD:214564
		VWD	1285..1432	CDD:365869
		C8	1482..1549	CDD:370094
		Glutenin_hmw	<1757..>1975	CDD:367362
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900