DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and 9530053A07Rik

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001158127.1 Gene:9530053A07Rik / 319482 MGIID:2442118 Length:2581 Species:Mus musculus


Alignment Length:177 Identity:38/177 - (21%)
Similarity:58/177 - (32%) Gaps:69/177 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DSSVAATDNDITHLGDDCQVTPVIHVLQYPG--CVPKPI--PSFACVGRCASYIQVSGSKIWQME 95
            |.|.||:.|:   |||..:..       .||  |.|:|.  |..||..:|...::    |.::.:
Mouse   987 DGSQAASSNE---LGDSWEKA-------VPGSSCTPRPSCKPGQACSPKCYPTLE----KKYRGK 1037

  Fly    96 RSC----------MCCQE----SGEREAAV----------SLFCPK--------------VKPGE 122
            ..|          ..|.:    .|..::.|          |:.|..              |||..
Mouse  1038 EFCGLITSPTGPLAACHKLLDPQGPLQSCVFDLCLGGGNQSILCSSIHAYVSACQAAGGTVKPWR 1102

  Fly   123 RKFKKVLTKAPLEC-------MCRPCTSIEESGI-IPQEIAGYSDEG 161
            .:     |..|:||       :|....|::.|.| .|.:......||
Mouse  1103 NQ-----TFCPMECPPHSHYEVCADTCSLDCSAITTPMQCLTPCSEG 1144

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 24/136 (18%)
9530053A07RikNP_001158127.1 VWD 56..212 CDD:278521
C8 257..326 CDD:214843
TIL 329..383 CDD:280072
VWD 448..598 CDD:278521
C8 644..714 CDD:285899
TIL 718..771 CDD:280072
VWC 773..827 CDD:302663