DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Muc14A

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_727928.3 Gene:Muc14A / 318097 FlyBaseID:FBgn0052580 Length:16223 Species:Drosophila melanogaster


Alignment Length:164 Identity:28/164 - (17%)
Similarity:60/164 - (36%) Gaps:43/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSVAATDNDITHLGDDCQVT-PVIHVLQYPGCVPK-------PIPSFACVGR------------C 80
            :.::.||.|...|.::..:: ..:|:.:....:||       .:|..:.:..            |
  Fly 10408 TKISNTDKDHPTLDEEENISKSPLHLSRTSSSLPKIQITGVSHLPFLSTISNIKFEQSSFHGCDC 10472

  Fly    81 ASYIQVSGSKIWQMERSCMC-C---QESGEREAAVS-----LFCPKVKPGERKFKKVLTKAPLEC 136
            ...:::.       :.||:| |   :.:.||..:|:     ::.|:   .......:||....|.
  Fly 10473 TCQLEIG-------KDSCICECNLKESTSERLKSVTASSLYIYLPQ---SSTTAHSLLTDLSAEN 10527

  Fly   137 MCRPCTSIEESGIIPQ----EIAGYSDEGPLNNH 166
            ......:.|.|..:||    ||:.:.:.....||
  Fly 10528 QTNQEETSELSKSLPQLTTEEISSFQESSAKENH 10561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 16/116 (14%)
Muc14ANP_727928.3 PRK14949 <11377..11776 CDD:237863
PRK08581 11922..>12215 CDD:236304
PRK14949 <13679..14114 CDD:237863
PRK14949 <14663..15055 CDD:237863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.