DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Kcp

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_038964921.1 Gene:Kcp / 296952 RGDID:1561119 Length:1671 Species:Rattus norvegicus


Alignment Length:101 Identity:26/101 - (25%)
Similarity:38/101 - (37%) Gaps:16/101 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VPKPIPSFAC-----VGRCASYIQVSGSKIWQME------RSCMCCQESGEREAAVSLFCPKVKP 120
            ||...|..:|     :..||. :|...:.||..:      .||..|:..|.:......|.|...|
  Rat  1095 VPADSPCSSCMCHKGIVTCAQ-VQCVSACIWPQQGPSDCCPSCSGCEHEGRKYEPGESFQPGDDP 1158

  Fly   121 GERKFKKVLTKAP--LECMCRPCTSIEESGIIPQEI 154
            .|....::..|.|  |.|..|.|.|:  .|..|.::
  Rat  1159 CEVCICELKGKGPPSLHCRRRQCPSL--VGCPPSQL 1192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 21/83 (25%)
KcpXP_038964921.1 VWC 227..281 CDD:278520
VWC 285..341 CDD:327433
VWC 405..460 CDD:327433
VWC 608..664 CDD:327433
VWC 725..781 CDD:327433
VWC 1022..1078 CDD:327433
VWC 1139..1204 CDD:327433 15/56 (27%)
VWC <1223..1264 CDD:327433
VWC 1271..1328 CDD:327433
VWD 1335..1484 CDD:395046
C8 1527..1599 CDD:214843
TIL 1610..1663 CDD:410995
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.