DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Otog

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001099732.1 Gene:Otog / 292918 RGDID:1306610 Length:2902 Species:Rattus norvegicus


Alignment Length:92 Identity:23/92 - (25%)
Similarity:37/92 - (40%) Gaps:6/92 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GDDCQVTPVIHVLQYPGCVPK-PIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVS 112
            |..|:...:...::...|... |:...:|.|||.| ..:....|....|.|.||:|.|.:..:|.
  Rat  2814 GRSCKKVTIRMTIRKNDCRSNTPVNLVSCDGRCPS-ASIYNHNINTYARFCKCCREVGLQRRSVQ 2877

  Fly   113 LFCPKVKPGERKFKKVLTKAPLECMCR 139
            |||..    ...:.....:.|.:|.|:
  Rat  2878 LFCAT----NATWVPYTVQEPTDCACQ 2900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 21/88 (24%)
OtogNP_001099732.1 VWD 143..293 CDD:278521
C8 339..403 CDD:285899
TIL 417..465 CDD:280072
VWC 467..>502 CDD:302663
VWD 505..660 CDD:278521
C8 700..761 CDD:285899
TIL 771..835 CDD:280072
TIL 875..937 CDD:280072
VWD 968..1122 CDD:214566
C8 1157..1231 CDD:214843
Fascin <1296..1387 CDD:304938
VWD 2089..2243 CDD:278521
C8 2279..2347 CDD:214843
TIL 2350..2411 CDD:280072
CT 2819..2901 CDD:214482 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.