DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Dand5

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_957679.1 Gene:Dand5 / 23863 MGIID:1344365 Length:185 Species:Mus musculus


Alignment Length:93 Identity:23/93 - (24%)
Similarity:42/93 - (45%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVS 112
            |.:.|:....:.|:..|||....:.:..|.|||:|:...|......:  .|..|..:.:|..:|:
Mouse    93 LQETCKALSFVQVISRPGCTSARVLNHLCFGRCSSFYIPSSDPTPVV--FCNSCVPARKRWTSVT 155

  Fly   113 LFCPKVKPGERKFKKVLTKAPLECMCRP 140
            |:|...:....:..::.|....:|.|||
Mouse   156 LWCGAGQLASPRRVRISTVLVQKCQCRP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 19/87 (22%)
Dand5NP_957679.1 GHB_like 81..181 CDD:304424 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.