DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Zan

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_035871.2 Gene:Zan / 22635 MGIID:106656 Length:5420 Species:Mus musculus


Alignment Length:171 Identity:35/171 - (20%)
Similarity:55/171 - (32%) Gaps:45/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILLYCVLVSILKLC--TAQPD--SSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKP------- 70
            |.|.|...|....|  ..||.  .|....:...|.....||          .|||.:|       
Mouse  2980 ITLQCPAHSHFTNCLPPCQPSCLDSEGHCEGSTTKAPSACQ----------EGCVCEPDYVVLNN 3034

  Fly    71 --IPSFACVGRCASYIQVSGSKIW---QMERSCMC------CQESGEREAAVSLFCPKVKPGERK 124
              :|...|..:.|..:.:...|.|   ...:||.|      ||:.   :.....:|..::.|...
Mouse  3035 KCVPRIECGCKDAQGVLIPADKTWINRGCTQSCTCKGGAIQCQKF---QCPSETYCKDIEDGNSN 3096

  Fly   125 FKKVLTKAP-----LECM--CRP-C--TSIEESGIIPQEIA 155
            ..::..:.|     ..|:  |:| |  |.:...|..|..::
Mouse  3097 CTRISLQCPANSNFTSCLPSCQPSCSNTDVHCEGSSPNALS 3137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 20/112 (18%)
ZanNP_035871.2 MAM 47..210 CDD:279023
MAM 47..208 CDD:99706
MAM 217..374 CDD:279023
MAM 217..371 CDD:99706
MAM 379..542 CDD:279023
MAM 379..540 CDD:99706
mucin-like domain 572..1170
DUF4758 729..899 CDD:292572
TIL 1215..1264 CDD:280072
TILa 1266..1319 CDD:289484
VWD 1326..1478 CDD:278521
C8 1521..1596 CDD:214843
TIL 1599..1652 CDD:280072
TILa 1654..1708 CDD:289484
VWD 1715..1865 CDD:278521
C8 1911..1982 CDD:214843
TIL 1985..2039 CDD:280072
VWC 2041..2096 CDD:302663
VWD 2102..2260 CDD:278521
C8 2310..2380 CDD:285899
TIL 2384..2442 CDD:280072
TILa 2444..2498 CDD:289484
TIL 2504..2562 CDD:280072
TILa 2564..2618 CDD:289484
TIL 2624..2682 CDD:280072
TILa 2684..2738 CDD:289484
TIL 2744..2802 CDD:280072
TILa 2804..2858 CDD:289484
TIL 2864..2922 CDD:280072
TILa 2924..2978 CDD:289484
TIL 2984..3042 CDD:280072 14/67 (21%)
TILa 3044..3098 CDD:289484 10/56 (18%)
TIL 3104..3162 CDD:280072 8/34 (24%)
TILa 3164..3218 CDD:289484
TIL 3224..3282 CDD:280072
TILa 3284..3338 CDD:289484
TIL 3344..3399 CDD:280072
TILa 3401..3455 CDD:289484
TIL 3461..3519 CDD:280072
TILa 3521..3575 CDD:289484
TIL 3581..3639 CDD:280072
TILa 3641..3695 CDD:289484
TILa 3761..3815 CDD:289484
TIL 3821..3879 CDD:280072
TILa 3881..3931 CDD:289484
TIL 3937..3995 CDD:280072
TILa 3997..4051 CDD:289484
TIL 4073..4131 CDD:280072
TILa 4133..4184 CDD:289484
TIL 4193..4251 CDD:280072
TILa 4253..4300 CDD:289484
TIL 4308..4366 CDD:280072
TILa 4368..4422 CDD:289484
TIL 4428..4486 CDD:280072
TILa 4488..4542 CDD:289484
TIL 4548..4606 CDD:280072
TILa 4608..4662 CDD:289484
TIL 4668..4726 CDD:280072
TILa 4728..4782 CDD:289484
TIL 4788..4846 CDD:280072
TILa 4848..4902 CDD:289484
VWD 4909..5062 CDD:278521
C8 5115..5191 CDD:214843
TIL 5194..5247 CDD:280072
VWC 5249..5302 CDD:302663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.