DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and Vwf

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	NP_035838.3	Gene:	Vwf / 22371	MGIID:	98941	Length:	2813	Species:	Mus musculus

Alignment Length:	92	Identity:	23/92 - (25%)
Similarity:	38/92 - (41%)	Gaps:	8/92 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    51 DCQ-VTPVIHVLQYPGC-VPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVSL 113
            ||: :|..:..::...| ..:.:....|.|:|||. .|....|..::..|.||..|......|.|
Mouse  2723 DCKDITAKVQYIKVGDCKSQEEVDIHYCQGKCASK-AVYSIDIEDVQEQCSCCLPSRTEPMRVPL 2786

  Fly   114 FCPKVKPGERKFKKVLTKAPLECMCRP 140
            .|..   |...:.:|:.  .::|.|.|
Mouse  2787 HCTN---GSVVYHEVIN--AMQCRCSP 2808

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	21/88 (24%)
Vwf	NP_035838.3	VWD	35..179	CDD:278521
		C8	218..292	CDD:214843
		TIL	295..348	CDD:280072
		VWC	350..>394	CDD:302663
		VWD	377..540	CDD:214566
		C8	580..648	CDD:285899
		TIL	652..707	CDD:280072
		Amino-terminal	764..787
		E1	788..833
		CX	826..853
		VWD	856..1011	CDD:214566
		C8	1053..1127	CDD:214843
		TIL	1146..1196	CDD:280072
		VWA_N2	1198..1276	CDD:292782
		VWA	1277..1449	CDD:214621
		VWA	1498..1658	CDD:278519
		VWA	1691..1860	CDD:278519
		VWD	1950..2102	CDD:278521
		C8	2136..2199	CDD:285899
		TIL	2203..2254	CDD:280072
		E2	2216..2261
		VWC	2257..2321	CDD:214564
		VWC	2431..2494	CDD:214564
		Cell attachment site. /evidence=ECO:0000250	2507..2509
		VWC	2582..2644	CDD:302663
		CT	2727..2808	CDD:214482	20/86 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900