DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and VWCE

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_689931.2 Gene:VWCE / 220001 HGNCID:26487 Length:955 Species:Homo sapiens


Alignment Length:187 Identity:41/187 - (21%)
Similarity:58/187 - (31%) Gaps:62/187 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KLCTAQPDSSVAATDNDITHLGDDCQVTPVIHVLQYPG-CVPKPIPSFACVGR------------ 79
            :||..|.|.||:....|..   |.|.     |.::.|| |.|.........||            
Human   590 ELCICQADGSVSCKRTDCV---DSCP-----HPIRIPGQCCPDCSAGCTYTGRIFYNNETFPSVL 646

  Fly    80 --CASYIQVSGSKI-------------WQMERSC--MC--CQESGEREAAVSLFCPKVKP----- 120
              |.|.|.:.||..             :..:..|  :|  |...|.:.|...:|....:|     
Human   647 DPCLSCICLLGSVACSPVDCPITCTYPFHPDGECCPVCRDCNYEGRKVANGQVFTLDDEPCTRCT 711

  Fly   121 ---GERKFKKVLTK--------APLECMCRPCTSI-----EESGIIPQEIAGYSDEG 161
               ||...:||..:        .|.:| |..|...     |:.|:.|.....:|..|
Human   712 CQLGEVSCEKVPCQRACADPALLPGDC-CSSCPDSLSPLEEKQGLSPHGNVAFSKAG 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 27/135 (20%)
VWCENP_689931.2 EGF_CA 142..180 CDD:214542
cEGF 200..223 CDD:315355
EGF_CA 220..262 CDD:214542
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..329
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..380
VWC 386..440 CDD:327433
VWC 501..559 CDD:327433
VWC 572..625 CDD:214564 14/42 (33%)
VWC 629..684 CDD:327433 8/54 (15%)
VWC 687..742 CDD:327433 12/55 (22%)
Atrophin-1 <726..944 CDD:331285 9/43 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 812..889
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 903..955
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.