DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and T09D3.3

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001343619.1 Gene:T09D3.3 / 188324 WormBaseID:WBGene00020384 Length:658 Species:Caenorhabditis elegans


Alignment Length:179 Identity:38/179 - (21%)
Similarity:58/179 - (32%) Gaps:51/179 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLVSILKLCTAQPDSSVAATDNDITHLGDDCQVTPVIHV-LQYPGCVPKPIPSFACVGRCASYIQ 85
            :|..:|.....:|:...|.         .:.|::|.:|: ..:|..||.|||....:......:.
 Worm   183 ILTQLLNPILQEPNIPTAP---------PNLQISPQMHINPNFPTLVPLPIPQPVVLEPTKEEVM 238

  Fly    86 VSGSK----------------IWQMERSCM-------CCQESGEREAAVSLFCPKVKPGE----R 123
            ...||                .:|...|||       ||:......|..:.....|.||.    .
 Worm   239 KIASKKNLYGMPRFPIEPHRGFFQASMSCMDGWCGNECCEPRRPFAAPTTTIQASVLPGSPSPPH 303

  Fly   124 KFKKVLTKAP-LEC--MCRP-CTSIEESGIIPQEIA--GYSDEGPLNNH 166
            ....|:..|| .:|  .|:| |:.        |.:|  .|..|....||
 Worm   304 PLVLVVHPAPQAQCSPACQPHCSQ--------QCVARLQYMHESQFYNH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 25/118 (21%)
T09D3.3NP_001343619.1 EBV-NA3 <86..323 CDD:332796 30/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.