DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and Otog

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	XP_017177514.1	Gene:	Otog / 18419	MGIID:	1202064	Length:	2917	Species:	Mus musculus

Alignment Length:	92	Identity:	23/92 - (25%)
Similarity:	37/92 - (40%)	Gaps:	6/92 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    49 GDDCQVTPVIHVLQYPGCVPK-PIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVS 112
            |..|:...:...::...|... |:...:|.|||.| ..:....|....|.|.||:|.|.:..:|.
Mouse  2829 GRSCKKVTIRMTIRKNDCRSNTPVNLVSCDGRCPS-ASIYNHNINTYARFCKCCREVGLQRRSVQ 2892

  Fly   113 LFCPKVKPGERKFKKVLTKAPLECMCR 139
            |||..    ...:.....:.|.:|.|:
Mouse  2893 LFCAT----NATWVPYTVQEPTDCACQ 2915

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	21/88 (24%)
Otog	XP_017177514.1	VWD	145..292	CDD:365869
		C8	343..405	CDD:370094
		TIL	420..467	CDD:366828
		VWC	469..>504	CDD:327433
		VWD	507..659	CDD:365869
		C8	706..765	CDD:370094
		TIL	773..837	CDD:366828
		TIL	877..939	CDD:366828
		VWD	970..1124	CDD:214566
		C8	1159..1233	CDD:214843
		Fascin	<1298..1389	CDD:390083
		PHA03247	<1459..1974	CDD:223021
		VWD	2104..2256	CDD:365869
		C8	2294..2362	CDD:214843
		TIL	2365..2426	CDD:366828
		CT	2834..2916	CDD:214482	21/87 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900