DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Nefm

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_032717.2 Gene:Nefm / 18040 MGIID:97314 Length:848 Species:Mus musculus


Alignment Length:59 Identity:16/59 - (27%)
Similarity:24/59 - (40%) Gaps:7/59 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGIIPQEIAGYSDEG 161
            ||..:|.||.    :|....:..|..|.|...|...:|...::|..   :|..|..:||
Mouse   668 ESPVKEKAVE----EVITISKSVKVSLEKDTKEEKLQPQEKVKEKA---EEEGGSEEEG 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 10/34 (29%)
NefmNP_032717.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Head 2..102
Filament_head 10..97 CDD:282575
Filament 98..409 CDD:278467
Coil 1A 103..134
Linker 1 135..147
Coil 1B 148..246
Linker 12 247..263
Coil 2A 264..285
Linker 2 286..289
Coil 2B 290..410
Tail 411..848 16/59 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..785 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.