DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and B0507.1

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001379585.1 Gene:B0507.1 / 179256 WormBaseID:WBGene00015218 Length:615 Species:Caenorhabditis elegans


Alignment Length:156 Identity:29/156 - (18%)
Similarity:48/156 - (30%) Gaps:54/156 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GDDCQVTPVIHVLQYPGCVPKPIPSFA--------CVGRCASYIQVSGS-KIWQMERSC------ 98
            |::|:...| :..|..||....:|..|        |.|..|..:..:|: .|..:...|      
 Worm    60 GEECRPGNV-NGRQKSGCFKSLVPKSALGGTSEDFCPGGGALVLSPTGTLTICDLTEDCPSTHIC 123

  Fly    99 -----MCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECM--------------------- 137
                 :||.:...        |||.|   :.....:|..|:.|.                     
 Worm   124 NPVHGVCCTKLPT--------CPKTK---KTMVNFITGKPIMCQFKQGRVMPCPENGFCETTTGF 177

  Fly   138 -CRPCTSIEESGIIPQEIAGYSDEGP 162
             |.|...:|...::.:..|...:|.|
 Worm   178 CCVPGVDVEPPVVVTRAPAIIENERP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 22/129 (17%)
B0507.1NP_001379585.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.