DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and BMPER

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001352237.1 Gene:BMPER / 168667 HGNCID:24154 Length:685 Species:Homo sapiens


Alignment Length:186 Identity:45/186 - (24%)
Similarity:59/186 - (31%) Gaps:66/186 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLILLYCVLVSILKLCTAQPDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGR 79
            ||:||.|..|. :.|.::....|||..:|:    |:         |||.|.....|.....|:.:
Human    25 VLLLLNCSGVP-MSLASSFLTGSVAKCENE----GE---------VLQIPFITDNPCIMCVCLNK 75

  Fly    80 ---------------CASYIQVSG------------------SKIWQM-ERSCMC--CQESGERE 108
                           ||..|:..|                  |..||. ...|:.  |||....|
Human    76 EVTCKREKCPVLSRDCALAIKQRGACCEQCKGCTYEGNTYNSSFKWQSPAEPCVLRQCQEGVVTE 140

  Fly   109 AAVSLFCPKVKPGERKFKKVLTKAPLE--CMCRP-CTSIEESGIIPQEIAGYSDEG 161
            :.|...             |..|.|||  .||.| |......|:..||...:..||
Human   141 SGVRCV-------------VHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQPEG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 24/125 (19%)
BMPERNP_001352237.1 VWC 166..224 CDD:278520 5/18 (28%)
VWC 301..357 CDD:327433
VWD 364..508 CDD:306577
C8 560..624 CDD:312319
TIL 629..682 CDD:307783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.