DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and LOC110437733

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	XP_021336078.1	Gene:	LOC110437733 / 110437733	-ID:	-	Length:	3005	Species:	Danio rerio

Alignment Length:	64	Identity:	19/64 - (29%)
Similarity:	25/64 - (39%)	Gaps:	21/64 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly    78 GRCAS-----------YIQVSGSKIWQMERS--CMCCQESGEREAAVSLFCP-----KVKPGER 123
            |:|.|           ||.| |.:.|.:|.|  |.|...:..|  ....|||     .|:.|:|
Zfish  1033 GQCVSVEQCGCSYDGFYINV-GERFWNLECSQVCQCFAPNDLR--CSGYFCPPTMECTVRNGQR 1093

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	19/64 (30%)
LOC110437733	XP_021336078.1	VWD	<2..98	CDD:214566
		C8	142..215	CDD:214843
		TIL	219..272	CDD:307783
		VWC	274..327	CDD:327433
		VWD	334..488	CDD:306577
		C8	528..598	CDD:214843
		TIL	602..652	CDD:307783
		VWC	657..712	CDD:327433
		VWD	719..876	CDD:306577
		C8	917..985	CDD:312319
		TIL	989..1041	CDD:307783	3/7 (43%)
		VWC	1043..1096	CDD:327433	16/54 (30%)
		NIDO	1200..1335	CDD:214712
		VWD	1398..1554	CDD:214566
		C8	1598..1671	CDD:214843
		TIL	1675..1728	CDD:307783
		VWC	1730..1783	CDD:327433
		VWD	1790..1944	CDD:306577
		C8	1984..2054	CDD:214843
		TIL	2058..2108	CDD:307783
		VWC	2113..2168	CDD:327433
		VWD	2175..2332	CDD:306577
		C8	2373..2441	CDD:312319
		TIL	2445..2497	CDD:307783
		Endomucin	<2550..>2645	CDD:330316
		Zona_pellucida	2694..2940	CDD:306582
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900