DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and si:ch211-39f2.3

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	XP_009305155.1	Gene:	si:ch211-39f2.3 / 100330672	ZFINID:	ZDB-GENE-131126-52	Length:	5336	Species:	Danio rerio

Alignment Length:	64	Identity:	20/64 - (31%)
Similarity:	27/64 - (42%)	Gaps:	21/64 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly    78 GRCAS-----------YIQVSGSKIWQMERS--CMCCQESGEREAAVSLFCP-----KVKPGER 123
            |:|.|           ||.| |.:.|.:|.|  |.|...:..|.:|  .|||     .|:.|:|
Zfish  3409 GQCVSVEQCGCSYDGFYINV-GERFWNLECSQVCQCFAPNDLRCSA--YFCPPTMECTVRNGQR 3469

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	20/64 (31%)
si:ch211-39f2.3	XP_009305155.1	NIDO	2120..2255	CDD:295411
		VWD	2308..2474	CDD:214566
		C8	2518..2591	CDD:214843
		TIL	2595..2648	CDD:280072
		VWC	2650..2703	CDD:302663
		VWD	2710..2864	CDD:278521
		C8	2904..2974	CDD:214843
		TIL	2978..3028	CDD:280072
		VWC	3033..3088	CDD:302663
		VWD	3095..3252	CDD:278521
		C8	3290..3361	CDD:285899
		TIL	3365..3417	CDD:280072	3/7 (43%)
		VWC	3419..3472	CDD:302663	17/54 (31%)
		NIDO	3576..3711	CDD:214712
		VWD	3774..3930	CDD:214566
		C8	3977..4047	CDD:285899
		TIL	4051..4104	CDD:280072
		VWC	4106..4159	CDD:302663
		VWD	4166..4320	CDD:278521
		C8	4360..4430	CDD:214843
		TIL	4434..4487	CDD:280072
		VWC	4489..4544	CDD:302663
		VWD	4551..4708	CDD:278521
		C8	4746..4817	CDD:285899
		TIL	4821..4873	CDD:280072
		ZP	5024..5273	CDD:214579
		Zona_pellucida	5153..5271	CDD:278526
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900