DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and muc5.1

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	XP_021326297.1	Gene:	muc5.1 / 100148804	ZFINID:	ZDB-GENE-120822-1	Length:	5282	Species:	Danio rerio

Alignment Length:	179	Identity:	38/179 - (21%)
Similarity:	56/179 - (31%)	Gaps:	69/179 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    31 TAQPDSSVAATDNDITHL---GDD---------CQ----------VTPVIHVLQYPGCVP----- 68
            |.:|::.:..:|| |||:   |:.         ||          ..|....:....|||
Zfish  5112 TCKPNACIYVSDN-ITHILSEGESYNYKCESVTCQQVNGTYIIERTIPTCPEINPDQCVPGTLGL 5175

  Fly    69 -------------------------------KPIPSFACVGRCASYIQVS-GSKIWQMERSCMCC 101
                                           .||...:|.|.|.:....| |:.  .|..||.||
Zfish  5176 DEDGCCNTCELKNCVRVKNMTDVTVNDCKSINPIEVTSCSGNCDTESMYSMGAN--TMMHSCSCC 5238

  Fly   102 QESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRP--CTSIEESG 148
            :|:......|:|.|  ....|.....|..::   |.|.|  |.:.:.||
Zfish  5239 KETKTSVKKVTLKC--ADGSEIPHDYVYIES---CRCTPITCENQKTSG 5282

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	25/143 (17%)
muc5.1	XP_021326297.1	VWD	72..217	CDD:214566
		C8	263..320	CDD:312319
		TIL	324..380	CDD:307783
		VWD	420..571	CDD:306577
		C8	606..680	CDD:214843
		Pacifastin_I	848..>874	CDD:253170
		VWD	867..1025	CDD:214566
		C8	1063..1135	CDD:214843
		Mucin2_WxxW	1386..1476	CDD:315900
		Mucin2_WxxW	1631..1721	CDD:315900
		Mucin2_WxxW	1895..1985	CDD:315900
		Mucin2_WxxW	2141..2231	CDD:315900
		Mucin2_WxxW	2366..2456	CDD:315900
		Mucin2_WxxW	2612..2702	CDD:315900
		Mucin2_WxxW	2814..2904	CDD:315900
		Mucin2_WxxW	3060..3150	CDD:315900
		Mucin2_WxxW	3306..3396	CDD:315900
		Mucin2_WxxW	3552..3642	CDD:315900
		Mucin2_WxxW	3798..3888	CDD:315900
		VWD	4616..4779	CDD:214566
		C8	4818..4880	CDD:312319
		CT	5198..5274	CDD:214482	21/82 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900