DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and zswim9

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_002941930.1 Gene:zswim9 / 100145494 XenbaseID:XB-GENE-6459081 Length:604 Species:Xenopus tropicalis


Alignment Length:134 Identity:30/134 - (22%)
Similarity:47/134 - (35%) Gaps:24/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GDDCQVTPVIHVLQYP----GCVPKPIPSFACVGRCASYIQVSGSKIWQME--RSC---MCCQES 104
            |.|......:..|:|.    ||  |.|.....:|......:.:||:.||.:  |||   :..:.|
 Frog   108 GSDPVDPQAVETLKYSSVRLGC--KNIKRMKGIGTYKVKKEDNGSEEWQPKHHRSCGAYILLKLS 170

  Fly   105 GEREAAVSLFCPKVKPGER---KFKKVLTKAPLECMCRPCTSIEESGIIPQEIAGYSD------- 159
            ..|.:.|.:.|......|.   .||....|..|  :...|..:..:..|.::.....|       
 Frog   171 HGRNSLVVIECQLTHSHELCPVAFKYYFKKGYL--LANACLPVRSTNEISKQFVSAQDIKRLLSY 233

  Fly   160 -EGP 162
             :||
 Frog   234 CKGP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 24/99 (24%)
zswim9XP_002941930.1 DUF5575 63..381 CDD:375303 30/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.