DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42335 and Aopep

DIOPT Version :9

Sequence 1:NP_732655.3 Gene:CG42335 / 42558 FlyBaseID:FBgn0259237 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_008769651.1 Gene:Aopep / 290963 RGDID:1309592 Length:886 Species:Rattus norvegicus


Alignment Length:414 Identity:94/414 - (22%)
Similarity:157/414 - (37%) Gaps:104/414 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 INARLVLPCFDEPALKAQFQLQ-------IVRPNGYQSIANTKLKETKALSQDRFVD-HFKETPV 221
            ||.|.:.||.:.|...:.:|..       :|..:|.:|...|.|:|       .::. |:..|..
  Rat   340 INNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGEKSAKPTPLRE-------GYMSWHYYVTMP 397

  Fly   222 M--STYLLAF-----MVANYSARGNESEFAVLTRP---EF-YDNT----EF-------------- 257
            |  ||:.:|.     |....|...:.:|..:..||   :| |.||    |:              
  Rat   398 MPASTFTIAVGCWTEMKPKTSPLDDLTEHTLPLRPSDADFRYGNTCSHMEYPCRFQSASAATQNI 462

  Fly   258 -SYHVGQQVV------------------SAYGELFQSPYAELGNDVLQYASSPRFPHNGMENWGL 303
             .|.|...|.                  :|:..|...|::.|  |:|...::  ||..||.:..:
  Rat   463 IPYRVFAPVCLEGACREALLWLIPSCLSAAHSVLGTHPFSRL--DILIVPTN--FPSLGMASPHI 523

  Fly   304 IIYSDDVLIQEPGYSDDWSDKEFAIRIIAHETSHMWFGDSVTFSWWSYFWLNEAFARYYE---YF 365
            |..|...|   .|.|.....:      :.||.:|.|||.::....|:..||:|.||.:.|   :.
  Rat   524 IFLSQSTL---TGTSHLCGTR------LCHEIAHAWFGLAIGARDWTEEWLSEGFATHLEDIFWA 579

  Fly   366 MAHQLYPDYHLDEQFV---VRQMQLIFGTDAQNGTQPM--------------TSPESEIQTPSQI 413
            .|.||.|...|::|.:   :|..:|  ..:.||..:.|              .|..|.::.....
  Rat   580 EAQQLPPHEALEQQELRACLRWHRL--QDELQNSPEGMQVLRPNKEKTGHVSASGASVVKNGLNP 642

  Fly   414 AYKFSGIAYAKGACIVRMWRNLMGAENFDTAIRSYLQQYHLTNTVPYNLFYHLFEHWPKNQ--DV 476
            ...|..:.|.||..::|.....:|.|.:...:|.::..:|....:..:....|.|..|:|:  .:
  Rat   643 EKGFMQVHYLKGYFLLRFLARTLGEETYFPFLRKFVHLFHGQLILSQDFLQMLLESIPENKRFGL 707

  Fly   477 DLVDFLTDYTEQVGYPMIIVKALQ 500
            .:.:.:.|:.|..|.|    ||||
  Rat   708 SVENIVGDWLECPGIP----KALQ 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42335NP_732655.3 Peptidase_M1 26..425 CDD:279741 75/335 (22%)
M1_APN_2 34..492 CDD:189008 89/404 (22%)
ERAP1_C 567..874 CDD:288671
AopepXP_008769651.1 GluZincin 250..697 CDD:301352 83/378 (22%)
Leuk-A4-hydro_C 743..884 CDD:286244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.