DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42335 and mnp-1

DIOPT Version :9

Sequence 1:NP_732655.3 Gene:CG42335 / 42558 FlyBaseID:FBgn0259237 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_497878.1 Gene:mnp-1 / 175564 WormBaseID:WBGene00007139 Length:781 Species:Caenorhabditis elegans


Alignment Length:240 Identity:54/240 - (22%)
Similarity:90/240 - (37%) Gaps:56/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PSHYNLTIGVLRNSVEPTIFDGEVSITLRVVGTLEVQQIILHA---------DTLDITECWLLDA 88
            |.||.|.|.:  ..|...:.:|.:.:......  :||.|.||:         |.:.:..|    .
 Worm   177 PIHYVLNITI--RDVRKPVLEGHMQLFASTKD--QVQAISLHSVKIHNLENRDRIHVVNC----N 233

  Fly    89 AGAQVEAIDISRLIYEAATQQVRVPLTEAAQPGKNYTLGFKYTGHIRTDMAGFFSAS---YVERD 150
            .|   |.|.:||:  ......:.:.|.::...|.|          :|.|:.||.||.   :|.:.
 Worm   234 TG---ETICVSRV--HQIDDLIHLELAQSISSGVN----------LRVDIDGFISADSGPHVFKQ 283

  Fly   151 TNVTRWLALTQM-----QRINARLVLPCFDEPALKAQFQLQIVRPNGYQSIANTKLKETKALSQD 210
            ....:| .:.||     :..:||.|.|.||....|:.|.|.:.......:|||:.:....:.|. 
 Worm   284 IPTAKW-RVPQMIGSVFEPTSARHVFPSFDLHNQKSTFNLCLNHGPSMSAIANSLINPNVSTSG- 346

  Fly   211 RFVDHFKETPVMSTYLLAFMVANYSARGNESEFAVLTRPEFYDNT 255
              :..|::|..:....|:|:...            .|.|.||:.|
 Worm   347 --ISCFEKTVPLIAQQLSFVAFE------------KTNPLFYNTT 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42335NP_732655.3 Peptidase_M1 26..425 CDD:279741 54/240 (23%)
M1_APN_2 34..492 CDD:189008 53/239 (22%)
ERAP1_C 567..874 CDD:288671
mnp-1NP_497878.1 Peptidase_M1 172..556 CDD:279741 54/240 (23%)
GluZincin <294..>480 CDD:301352 23/99 (23%)
GluZincin <547..602 CDD:301352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11533
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.