DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PolA1 and AT1G49180

DIOPT Version :10

Sequence 1:NP_536736.2 Gene:PolA1 / 42553 FlyBaseID:FBgn0259113 Length:1488 Species:Drosophila melanogaster
Sequence 2:NP_175344.2 Gene:AT1G49180 / 841341 AraportID:AT1G49180 Length:408 Species:Arabidopsis thaliana


Alignment Length:223 Identity:50/223 - (22%)
Similarity:91/223 - (40%) Gaps:62/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   687 MGRLRLSQSFGKR--LLEHFVGRMVCDVKRSAEECIRARSYDLQTLCKQVLKLKESERMEVNADD 749
            :.:.:||:|....  |.:|         |.:.||.: .:.:||..|.:.:.....:|...:::.|
plant     8 IAKSKLSESLTSTVWLAKH---------KLTGEEAV-MKCFDLSKLNRNLRDCLNNELEFLSSVD 62

  Fly   750 LLEMYEKGESITKLISLTMQDNSYLLRLM--CELNIMPLALQITNICGNTMTRTLQG-GRSERN- 810
                   ..:|.:|:.:: ||:.:|:.::  |:              |.|::..:|. ||.|.: 
plant    63 -------HPNIIRLLHVS-QDDDFLVMVLEYCD--------------GGTLSSYIQRYGRVEEDI 105

  Fly   811 --EFLL-----LHAFHEKNYIVPDKKPVS-KRSGAGDTDATLSGADATMQTKKKAAYAGGLVLEP 867
              .|:.     |...|:.:.|..|.||.: ...|:|| |..|..||.::..|          |.|
plant   106 AKRFMKQIGAGLEIIHDNHIIHRDLKPENILIDGSGD-DLVLKIADFSLARK----------LHP 159

  Fly   868 MRGLYEKYVLLMDFNSLYPSII--QEYN 893
              |.|.:.|....| .:.|.::  |.||
plant   160 --GKYLETVCGSPF-YMAPEVLQFQRYN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PolA1NP_536736.2 pol2 52..1237 CDD:273159 50/223 (22%)
zf-DNA_Pol 1286..1459 CDD:462651
AT1G49180NP_175344.2 STKc_ATG1_ULK_like 13..261 CDD:270911 50/218 (23%)
PTZ00166 <248..>354 CDD:240301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.