DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15497 and CG17189

DIOPT Version :9

Sequence 1:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:248 Identity:47/248 - (18%)
Similarity:91/248 - (36%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TDLKHLLGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDY--NIKPFDPHHCSYVELRRGES---- 95
            |:....:..|...:.:|.:|..:...........|||:.  :..|.||.....:..::..|    
  Fly    24 TEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMRQEQLVFKQDNSDVAT 88

  Fly    96 ----------QGLGSFRLILRNVS--EYGWARSEVTKFHADPEDQRIVYTQYFPDKSLEGEYEFA 148
                      :|.|...:....||  ::.|    :||.             |.|...::|.|:..
  Fly    89 LSANLTDMLIRGFGKMLIKESKVSKKDFSW----LTKI-------------YLPQMRIDGHYKMV 136

  Fly   149 AKMLGTEMNRKGHWNLTL--YDYSQTTSVRRIGGPG----SLIKVHVEVDRIGGMELHIENLLQG 207
            .::|...:...|...:.:  .|...||..|.....|    ::..|.|:|| :|.:...::||..|
  Fly   137 GRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVD-VGKVRTRLDNLFNG 200

  Fly   208 --QPLNQLADGVINSMWQLGLPFIKPMINELVSTAFTDIFNESFRHFPLEKFL 258
              :.:....:...|..|:.....::|::.|.|.....|:.:::|..||...|:
  Fly   201 HSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15497NP_650976.1 JHBP 26..258 CDD:284096 46/246 (19%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 47/248 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.