DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15497 and to

DIOPT Version :9

Sequence 1:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:259 Identity:56/259 - (21%)
Similarity:87/259 - (33%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CHWSDEDFNECMRQVFNDLRAYFTT-GVPDYNIKPFDPHHCSYVELRRGESQGLGSFRLILRNVS 109
            |.:.|   .||:.::.|.|.:..:. |.|..|:...||.....:.:.:|||.......|...:..
  Fly    27 CKYGD---GECIMKLCNTLFSENSAEGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNL 88

  Fly   110 EYGWARSEVTKFHADPEDQRIVYTQYF--------------PDKSLEGEYEFAAKMLGTEMNRKG 160
            .||            .:|||||..:.|              ...||.|.|....|:|...::..|
  Fly    89 LYG------------IKDQRIVKVKGFGRDLTAKHEVKIVTKTFSLVGPYNIQGKVLILPISGTG 141

  Fly   161 HWNLTLYDYSQTTSVRRI----GGPGSLIK---VHVEVDRI------GGMELHIENLLQGQP--- 209
            ..|:|:      .:||.|    |.|  |:|   .:::|..:      .....|..||..|..   
  Fly   142 QSNMTM------VNVRAIVSFSGKP--LVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALG 198

  Fly   210 ------LN--------QLADGVINSMWQLGLPFIKPMINELVSTAFTDIFNESFRHFPLEKFLA 259
                  ||        :.|..:..|..:|.|..:|.:.::|                |..||.|
  Fly   199 DNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKL----------------PYAKFFA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15497NP_650976.1 JHBP 26..258 CDD:284096 54/256 (21%)
toNP_001287525.1 JHBP 5..245 CDD:284096 54/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.