DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15497 and CG7079

DIOPT Version :9

Sequence 1:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:244 Identity:55/244 - (22%)
Similarity:96/244 - (39%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RCHWSDEDFNECMRQVFNDLRAYFTTGVPDYNIKPFDPHHCSYVELRR----GESQGLGS---FR 102
            :||:.|   .:|:.:..|.|...|..|:|:.::|||     :.:.:|.    .:||..|:   |.
  Fly    28 KCHFGD---GKCLVESANALLRDFPKGIPEVDLKPF-----NVLSVRDWLLVNDSQVGGAWYYFN 84

  Fly   103 LILRNVSEYGWARSEVTK---FHADPEDQRIVYTQYFPDKSLEGEYEFAAKMLGTEMNRKGHWNL 164
            ||  |...||:..:.:|:   |..||...:|......|....:|:|....:||         |.:
  Fly    85 LI--NQINYGFENTTITEIRGFDKDPTTTKIEIHGKIPRLVYKGDYVAKGRML---------WFV 138

  Fly   165 TLYDYSQTTSVRRIGGPGSLIKVHVEVD-----------------RIGGMELHIENLL-QGQPLN 211
            .:  :||.||.........::.:.|.|:                 |:....:.::|.. ..:.|.
  Fly   139 DI--HSQGTSESDFLNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWIMWLDNFFPDNEDLT 201

  Fly   212 QLADGVINSMWQLGLPFIKPMINELVSTAFTDIFNESFRHFPLEK-FLA 259
            ...:.:.|..|......::|.|..|..|.|..:|.:.|...|.:. |||
  Fly   202 IAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLFLA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15497NP_650976.1 JHBP 26..258 CDD:284096 52/241 (22%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 52/241 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.