DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15497 and CG10264

DIOPT Version :9

Sequence 1:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster


Alignment Length:235 Identity:56/235 - (23%)
Similarity:100/235 - (42%) Gaps:32/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDYNIKPFDPHHCSYVELRRGESQGL--GSFR-LI 104
            |..|..|:.:.::|.||:|.........|:|:..:|.|:|.:...|.:.:|....:  |.|: |:
  Fly    48 LQTCKRSNPNEDKCFRQLFEGCFPALAAGIPEIGVKSFEPLNIDQVSVSKGSGNLVLSGGFQDLV 112

  Fly   105 LRNVSEYGWARSEVTKFHADPEDQRIVYTQYFPDKSLEGEYEFAAKMLGTEMNRKGHWNLTLYDY 169
            :|     |.:.:.|.:...|.|.:.:.:....|...:..:|.....:|...:...|...:.|.:.
  Fly   113 IR-----GPSNATVRRASLDLERRLLNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKNV 172

  Fly   170 SQTT----SVRRIGGPGSLIKVHVEVDR----IGGMELHIENLLQGQPLNQLADGVINS-MWQLG 225
            ..|.    |:|.....|..| :|::..:    :|.|.:|::||..|   |::....||| :.|.|
  Fly   173 HTTVYTRISLRNETRTGDEI-IHIDEMKVGFDVGAMRIHLKNLFNG---NEILAASINSFLNQNG 233

  Fly   226 LPFIKPMINEL---VSTAFTDIF----NESFRHFPLEKFL 258
                |.:|.||   :.....|||    |..|...|.:.:|
  Fly   234 ----KEVIAELRPDLELGLADIFHGLWNNVFSKMPTKLWL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15497NP_650976.1 JHBP 26..258 CDD:284096 55/233 (24%)
CG10264NP_650518.1 JHBP 42..270 CDD:214779 56/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.