DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15497 and CG1124

DIOPT Version :9

Sequence 1:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:238 Identity:44/238 - (18%)
Similarity:99/238 - (41%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VDTDLKHLLGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDYNIKPFDPHHCSYVELRRGESQGLG 99
            |..:....:.:||.:|....:|.......|:.|...|:||..:...:|.....:.|:.  ::|..
  Fly    17 VQAETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDTLALQL--TEGPQ 79

  Fly   100 SFRLILRNVSEYGWARSEVTKFH----ADPEDQRIVYTQYFPDKSLEGEYEFAAKMLGTEMNRKG 160
            .:::.|:|:..:|.:..:||...    ::|...:||    .|...:|.:|..:..:|....:..|
  Fly    80 GYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIV----MPKLKIEAKYTSSGVLLILPASGGG 140

  Fly   161 HWNLTL----YDYSQTTSVRRIGGPGSLIKVHVE----VDRIGGMELHIENLLQGQPLNQLADGV 217
            .::...    .|.:..||:....|...|   |::    |..:..:::.|........:...|..:
  Fly   141 DFHANFEGVSADLTGKTSIHAFKGANYL---HIDALSLVLDVKDVKMSISGAFNNNRILLEATNL 202

  Fly   218 I---NSMWQLGLPFIKPMINELVSTAFTDIFNESFRHFPLEKF 257
            .   ||  |:.|..::..:.:.:::.|..:.|:..::.|:|:|
  Fly   203 FLRENS--QVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15497NP_650976.1 JHBP 26..258 CDD:284096 44/238 (18%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 44/238 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.