DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15497 and CG14661

DIOPT Version :9

Sequence 1:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:238 Identity:51/238 - (21%)
Similarity:98/238 - (41%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLVYLAGISLFANHLANASSQIDVDTDLKHLLGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDYN 76
            |:.::|.||     ..|....|.|          ||.:|.:.::|::...::||.|...|:.:.|
  Fly    11 LICFVACIS-----AGNMPDYIQV----------CHRNDPELSKCLKSSVHNLRPYLAKGIKELN 60

  Fly    77 IKPFDPHHCSYVELRRGESQGLGSFRLILRNVSEYGWARSEVTKFHADPEDQRIVYTQYFPDKSL 141
            :.|.:|.:...:.:..| |.||   .:..:.::..|.:..|:||..|..:::|..:....|....
  Fly    61 VPPLEPLYIGDLSILDG-SAGL---TVKAKKLNILGASNFEITKLRASTQNRRFDFELILPHLHG 121

  Fly   142 EGEYEFAAKMLGTEMNRKGHW--NLT--------LYDYSQTTSVRRIGGPGSLIKVHVEVDRIGG 196
            :|.||....:|...:...|.:  |.|        .||......:..:.....::|:     |.|.
  Fly   122 DGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKI-----RTGK 181

  Fly   197 MELHIENLLQG-QPLNQLADGVINSMWQLGLPFIKPMINELVS 238
            ..|.:|||..| :.|..:.:..||..:::       ..|:|::
  Fly   182 GNLKLENLFNGDKVLGDVINDTINQNFEV-------FTNDLIA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15497NP_650976.1 JHBP 26..258 CDD:284096 47/224 (21%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 51/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470570
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.