DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15497 and CG5945

DIOPT Version :9

Sequence 1:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster


Alignment Length:242 Identity:58/242 - (23%)
Similarity:104/242 - (42%) Gaps:13/242 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LANASSQIDVDTDLKHLLGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDYNIKPFDPHHCSYVEL 90
            ||...|....|.:....|.:|...::...||::|:||.|......|.|:..|:|::|.|.:....
  Fly    11 LALGCSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELRIEPYEPLHLNRTSF 75

  Fly    91 RRGESQGLGSFRLILRNVSEYGW----ARSEVTKFHADPEDQRIVYTQYFPDKSLEGEYEFAAKM 151
            :  .|.|..:.|:.:||...||:    |:....|.:.|....|:| || .|..::.|.|:...::
  Fly    76 Q--YSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLV-TQ-MPKLNIVGSYKADMQV 136

  Fly   152 LGTEMNRKGHWNLTLYDYSQTTSV-----RRIGGPGSLIKVHVEVDRIGGMELHIENLLQGQPLN 211
            ...::..||.:|:||.|....|..     .:.|.....:|......:|..:.:....:.....|:
  Fly   137 NQLQLKPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPKIKDLVIKANGIFADPELD 201

  Fly   212 QLADGVINSMWQLGLPFIKPMINELVSTAFTDIFNESFRHFPLEKFL 258
            ::|..|.|..|:.....:.|...:........:|||:|...|:::||
  Fly   202 KIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQFL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15497NP_650976.1 JHBP 26..258 CDD:284096 56/240 (23%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 54/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.