DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15497 and CG5867

DIOPT Version :9

Sequence 1:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster


Alignment Length:270 Identity:64/270 - (23%)
Similarity:114/270 - (42%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVYLAGISLFANHLANASSQIDV-DTDLKHL------LGRCHWSDEDFNECMRQVFNDLRAYFTT 70
            |:.:||:.|        :::|:: ..:.|.:      :..|...|.:.:||::|....:......
  Fly    10 LILMAGLCL--------AAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMKY 66

  Fly    71 GVPDYNIKPFDPHH---CSYVELRRGESQGLGSFRLILRNVSEYGWARSEVTKFHADPEDQRI-- 130
            |:.:.||.|.||..   .||     ..:.||...|:.::||..:|.:...|.|.:...:|.|:  
  Fly    67 GISELNIPPLDPFEMGKSSY-----SYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRM 126

  Fly   131 VYTQYFPDKSLEGEYEFAAKMLGTEMNRKGHWNLTLYDYSQTTSVRRIG------GPGSLIKVHV 189
            ....:.|...:||.|:...|:...::|.||.:|:|:.|.:.  ..|.||      |...|....:
  Fly   127 EILSHVPQMFVEGLYKADIKLNDLKLNPKGAFNITMTDVAM--RARPIGELYERDGHTYLRLTKL 189

  Fly   190 EVD-RIGGMELHIENLLQGQPLNQLADGVINSMW----QLGLPFI----KPMINELVSTAFTDIF 245
            |.: ::|.::.:...|:....||.:....||..|    |..||..    :|:|  |.||      
  Fly   190 ETEPKVGDLKFYANGLVPDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLI--LKST------ 246

  Fly   246 NESFRHFPLE 255
            |:.|...|.:
  Fly   247 NDFFAALPFD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15497NP_650976.1 JHBP 26..258 CDD:284096 60/257 (23%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 58/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.