DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Archease and zbtb8os

DIOPT Version :9

Sequence 1:NP_650975.1 Gene:Archease / 42551 FlyBaseID:FBgn0038893 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001017687.1 Gene:zbtb8os / 550382 ZFINID:ZDB-GENE-050417-176 Length:162 Species:Danio rerio


Alignment Length:141 Identity:79/141 - (56%)
Similarity:103/141 - (73%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KYEYLDHTADVQIHGWGSSLKEAFEQCGVAMFGYMTELDYVSVEQCFEIEAHGDDLESLLFHFLD 80
            ||||||||||||||.||:||:||||||.:.:|||||:.:.|......|:|:.|||:||||:||||
Zfish    25 KYEYLDHTADVQIHSWGNSLEEAFEQCAMGVFGYMTDTETVEPIDTVEVESEGDDMESLLYHFLD 89

  Fly    81 ELLFLFSAEPYLVCKKLEITKFDVENFEISCHCYGEPFELGKHPQGTEVKAITYSAMQIIQDVEA 145
            :.||.|||:.:.:.:::::...|...::|....:||.|.:.||||||||||||||||||   .|.
Zfish    90 DWLFKFSADIFFIPREVKVLHIDRMRYKIRSIGWGEEFSINKHPQGTEVKAITYSAMQI---HET 151

  Fly   146 SNYEVFVIIDI 156
            ...|:||||||
Zfish   152 EQPEIFVIIDI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArcheaseNP_650975.1 Archease 17..156 CDD:280182 76/138 (55%)
zbtb8osNP_001017687.1 Archease 26..162 CDD:280182 76/138 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594215
Domainoid 1 1.000 162 1.000 Domainoid score I3964
eggNOG 1 0.900 - - E1_COG1371
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12083
Inparanoid 1 1.050 164 1.000 Inparanoid score I4179
OMA 1 1.010 - - QHG60729
OrthoDB 1 1.010 - - D1360804at2759
OrthoFinder 1 1.000 - - FOG0006274
OrthoInspector 1 1.000 - - oto40829
orthoMCL 1 0.900 - - OOG6_103121
Panther 1 1.100 - - LDO PTHR12682
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2402
SonicParanoid 1 1.000 - - X5224
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.