DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Archease and zbtb8os

DIOPT Version :9

Sequence 1:NP_650975.1 Gene:Archease / 42551 FlyBaseID:FBgn0038893 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_012812452.1 Gene:zbtb8os / 549545 XenbaseID:XB-GENE-489455 Length:167 Species:Xenopus tropicalis


Alignment Length:137 Identity:79/137 - (57%)
Similarity:101/137 - (73%) Gaps:3/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDHTADVQIHGWGSSLKEAFEQCGVAMFGYMTELDYVSVEQCFEIEAHGDDLESLLFHFLDELLF 84
            ||||||||:|.||.:|:||||||.:|||||||:::.|......|:...|:||.||||:||||.|:
 Frog    34 LDHTADVQLHAWGETLEEAFEQCAMAMFGYMTDIETVEPLDTVEVVTEGEDLISLLFNFLDEWLY 98

  Fly    85 LFSAEPYLVCKKLEITKFDVENFEISCHCYGEPFELGKHPQGTEVKAITYSAMQIIQDVEASNYE 149
            .|||:.|.|.:::::...|..||:|....:||.|.|.||||||||||||||||||.::.:|   |
 Frog    99 KFSADQYFVPREVKVLNIDRMNFKIRSIGWGEEFSLTKHPQGTEVKAITYSAMQIHEEEKA---E 160

  Fly   150 VFVIIDI 156
            |||||||
 Frog   161 VFVIIDI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArcheaseNP_650975.1 Archease 17..156 CDD:280182 77/135 (57%)
zbtb8osXP_012812452.1 Archease 34..167 CDD:376680 77/135 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4149
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12083
Inparanoid 1 1.050 156 1.000 Inparanoid score I4192
OMA 1 1.010 - - QHG60729
OrthoDB 1 1.010 - - D1360804at2759
OrthoFinder 1 1.000 - - FOG0006274
OrthoInspector 1 1.000 - - oto103731
Panther 1 1.100 - - LDO PTHR12682
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2402
SonicParanoid 1 1.000 - - X5224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.