DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Archease and ZBTB8OS

DIOPT Version :9

Sequence 1:NP_650975.1 Gene:Archease / 42551 FlyBaseID:FBgn0038893 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001353193.1 Gene:ZBTB8OS / 339487 HGNCID:24094 Length:191 Species:Homo sapiens


Alignment Length:153 Identity:86/153 - (56%)
Similarity:101/153 - (66%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KYEYLDHTADVQIHGWGSSLKEAFEQCGVAMFGYMTELDYVSVEQCFEIEAHGDDLESLLFHFLD 80
            ||||||||||||:|.||.:|:||||||.:|||||||:...|...|..|:|..||||:||||||||
Human    42 KYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLD 106

  Fly    81 ELLFLFSAE---------PYLVCKKLEITKFDVENFEI-SCHCY--GEPFELGKHPQGTEVKAIT 133
            |.|:.|||:         ||:....|::.......|.: .|..|  ||.|.|.||||||||||||
Human   107 EWLYKFSADEFFIPRMRSPYVAQAVLKLLGSSDPPFGLRKCQDYRWGEEFSLSKHPQGTEVKAIT 171

  Fly   134 YSAMQIIQDVEASNYEVFVIIDI 156
            |||||:..:   .|.||||||||
Human   172 YSAMQVYNE---ENPEVFVIIDI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArcheaseNP_650975.1 Archease 17..156 CDD:280182 83/150 (55%)
ZBTB8OSNP_001353193.1 Archease 43..191 CDD:307874 83/150 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158295
Domainoid 1 1.000 170 1.000 Domainoid score I3800
eggNOG 1 0.900 - - E1_COG1371
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12083
Inparanoid 1 1.050 172 1.000 Inparanoid score I4101
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60729
OrthoDB 1 1.010 - - D1360804at2759
OrthoFinder 1 1.000 - - FOG0006274
OrthoInspector 1 1.000 - - oto89918
orthoMCL 1 0.900 - - OOG6_103121
Panther 1 1.100 - - LDO PTHR12682
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2402
SonicParanoid 1 1.000 - - X5224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.