DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Archease and Zbtb8os

DIOPT Version :9

Sequence 1:NP_650975.1 Gene:Archease / 42551 FlyBaseID:FBgn0038893 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_003750084.3 Gene:Zbtb8os / 297885 RGDID:1562249 Length:167 Species:Rattus norvegicus


Alignment Length:141 Identity:83/141 - (58%)
Similarity:105/141 - (74%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KYEYLDHTADVQIHGWGSSLKEAFEQCGVAMFGYMTELDYVSVEQCFEIEAHGDDLESLLFHFLD 80
            ||||||||||||:|.||.:|:||||||.:|||||||:...|...|..|:|..||||:||||||||
  Rat    30 KYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLD 94

  Fly    81 ELLFLFSAEPYLVCKKLEITKFDVENFEISCHCYGEPFELGKHPQGTEVKAITYSAMQIIQDVEA 145
            |.|:.|||:.|.:.:::::...|.:||::....:||.|.|.|||||||||||||||||:..:.:.
  Rat    95 EWLYRFSADEYFIPREVKVLNIDQKNFKLRSIGWGEEFSLSKHPQGTEVKAITYSAMQVYNEEKP 159

  Fly   146 SNYEVFVIIDI 156
               ||||||||
  Rat   160 ---EVFVIIDI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArcheaseNP_650975.1 Archease 17..156 CDD:280182 80/138 (58%)
Zbtb8osXP_003750084.3 Archease 31..167 CDD:280182 80/138 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352278
Domainoid 1 1.000 170 1.000 Domainoid score I3698
eggNOG 1 0.900 - - E1_COG1371
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12083
Inparanoid 1 1.050 172 1.000 Inparanoid score I4012
OMA 1 1.010 - - QHG60729
OrthoDB 1 1.010 - - D1360804at2759
OrthoFinder 1 1.000 - - FOG0006274
OrthoInspector 1 1.000 - - oto97034
orthoMCL 1 0.900 - - OOG6_103121
Panther 1 1.100 - - LDO PTHR12682
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5224
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.