DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Archease and arch-1

DIOPT Version :9

Sequence 1:NP_650975.1 Gene:Archease / 42551 FlyBaseID:FBgn0038893 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_492778.1 Gene:arch-1 / 183428 WormBaseID:WBGene00016621 Length:155 Species:Caenorhabditis elegans


Alignment Length:143 Identity:69/143 - (48%)
Similarity:97/143 - (67%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KYEYLDHTADVQIHGWGSSLKEAFEQCGVAMFGYMTELDYVSVEQCFEI--EAHGDDLESLLFHF 78
            ::|||||.||:|:|.|||:::||||.|.|:||||||:|  ..|::.:|.  :|.||.|:.|||.|
 Worm    17 RFEYLDHPADIQLHSWGSTMEEAFEACLVSMFGYMTDL--AKVDEMYEFYWKASGDSLDGLLFQF 79

  Fly    79 LDELLFLFSAEPYLVCKKLEITKFDVENFEISCHCYGEPFELGKHPQGTEVKAITYSAMQIIQDV 143
            |||.|..|.|||..|.|::||.:||.:.|||....:||.|:..||....::|:.|||.|||.:..
 Worm    80 LDEALNSFHAEPCFVAKRVEILRFDKKKFEIEFRGWGESFDTSKHETEADIKSPTYSNMQINEKP 144

  Fly   144 EASNYEVFVIIDI 156
            |  ..:::||:||
 Worm   145 E--RCDIYVIVDI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArcheaseNP_650975.1 Archease 17..156 CDD:280182 67/140 (48%)
arch-1NP_492778.1 Archease 18..155 CDD:280182 67/140 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165994
Domainoid 1 1.000 136 1.000 Domainoid score I3068
eggNOG 1 0.900 - - E1_COG1371
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12083
Inparanoid 1 1.050 137 1.000 Inparanoid score I3121
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60729
OrthoDB 1 1.010 - - D1360804at2759
OrthoFinder 1 1.000 - - FOG0006274
OrthoInspector 1 1.000 - - oto18897
orthoMCL 1 0.900 - - OOG6_103121
Panther 1 1.100 - - LDO PTHR12682
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2402
SonicParanoid 1 1.000 - - X5224
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.