DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and ATE2F2

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_175222.1 Gene:ATE2F2 / 841202 AraportID:AT1G47870 Length:396 Species:Arabidopsis thaliana


Alignment Length:396 Identity:104/396 - (26%)
Similarity:174/396 - (43%) Gaps:66/396 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 AATAGHTQQQLQQQHHHQNQQQRKATGKSNDITNYYKV----KRRPHAVSDEIHPKKQAKQ--SA 180
            |||:...:......||....:.......|:....|..:    ..||.:||..: |..|...  |.
plant     2 AATSNSGEDPTLSYHHRSPFRFELLQSISSSDPRYSSLTPSSTNRPFSVSQSL-PNSQLSPLISP 65

  Fly   181 HHQTVYQKHTASSAPQQLRHSHH-QLRHDADAELDE--DVVERVAKPASHHPFSLSTPQQQLAAS 242
            |....|.:.|  ...|:.|.:|. ||...|:....|  |:.:.:.|..       |:||.  ...
plant    66 HWDDSYSQIT--QKVQKSRKNHRIQLGSIANMSGGESIDIAKVIVKQE-------SSPQN--VKR 119

  Fly   243 VASSSSSGDR------------------------NRADTSLGILTKKFVDLLQESPDGVVDLNEA 283
            |.:.|..|.:                        .|.|:|||:||||||.|:||:.||.:|||..
plant   120 VYNKSKGGTKLLKAGKRMANGEVQNGGLNGASINCRYDSSLGLLTKKFVKLIQEAEDGTLDLNYC 184

  Fly   284 SNRLHVQKRRIYDITNVLEGINILEKKSKNNIQWRCGQSMVSQERSRHIEADSLRLEQQENELNK 348
            :..|.||||||||||||||||.::||.:||:|:|:...::..::....|......:|..::|.::
plant   185 AVVLEVQKRRIYDITNVLEGIGLIEKTTKNHIRWKGADNLGQKDLGDQISRLKSEVESMQSEESR 249

  Fly   349 AIDLMRENLAEIS--QEVENSGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKL-VRSATALKFQ 410
            ..||:||....:.  :|.:......::|:.|:.::..|::|.::.||||..:.: |.....:.| 
plant   250 LDDLIRERQEALRSLEEDDYCRRYMFMTEEDITSLPRFQNQTLLAIKAPTASYIEVPDPDEMSF- 313

  Fly   411 PLPFNLNLPNTKLPREIYV-------KAENSGEINVFLCHDTSPENSPIAPGAGYVGAPGAGCVR 468
            |..:.:.:.:...|.::|:       .||.|.::.     :.|.:.:|:.     |..|....|.
plant   314 PQQYRMVIRSRMGPIDVYLLSKYKGDSAETSDKLG-----NESDQKAPVG-----VDTPSLKIVT 368

  Fly   469 TATSTR 474
            :.|..:
plant   369 SDTDLK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 40/61 (66%)
E2F_DD 327..444 CDD:304549 24/126 (19%)
coiled coil 327..362 CDD:271137 7/36 (19%)
ATE2F2NP_175222.1 E2F_TDP 157..220 CDD:280479 41/62 (66%)
E2F_DD 231..336 CDD:271137 21/105 (20%)
coiled coil 231..266 CDD:271137 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2583
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - otm2498
orthoMCL 1 0.900 - - OOG6_101186
Panther 1 1.100 - - O PTHR12081
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X977
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.