DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and E2F3

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_973610.1 Gene:E2F3 / 818174 AraportID:AT2G36010 Length:514 Species:Arabidopsis thaliana


Alignment Length:244 Identity:82/244 - (33%)
Similarity:126/244 - (51%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 STPQQQLAASVASSSSSGDRNRADTSLGILTKKFVDLLQESPDGVVDLNEASNRLHVQKRRIYDI 297
            ||||..::.:...|..........|||  ||||||:|::::.||::|||:|:..|.|||||||||
plant   194 STPQTPISTNAVRSFYEISFMSRVTSL--LTKKFVNLIKQAKDGMLDLNKAAETLEVQKRRIYDI 256

  Fly   298 TNVLEGINILEKKSKNNIQWRCGQSMVSQERSRHIEADSLRLEQQENELNKAIDLMRENLAEISQ 362
            |||||||:::||..||.|.|:...:....|     :|| :.:.|.:.|:        ||||...|
plant   257 TNVLEGIDLIEKPFKNRILWKGVDACPGDE-----DAD-VSVLQLQAEI--------ENLALEEQ 307

  Fly   363 EVENSGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKLVRSATALKFQPLP----------FNLN 417
            .::|.....:||:.|:.::..|::|.:|.:|||       ..|.|:. |.|          :.:.
plant   308 ALDNQIRWLFVTEEDIKSLPGFQNQTLIAVKAP-------HGTTLEV-PDPDEAADHPQRRYRII 364

  Fly   418 LPNTKLPREIYVKAENSGEINVFLCHDTS------PENSPIAPGAGYVG 460
            |.:|..|.::|:.:|..|:.     .||:      |...|||..:|..|
plant   365 LRSTMGPIDVYLVSEFEGKF-----EDTNGSGAAPPACLPIASSSGSTG 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 38/61 (62%)
E2F_DD 327..444 CDD:304549 30/126 (24%)
coiled coil 327..362 CDD:271137 9/34 (26%)
E2F3NP_973610.1 E2F_TDP 219..278 CDD:280479 38/60 (63%)
E2F_CC-MB 295..378 CDD:293030 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2583
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - otm2498
orthoMCL 1 0.900 - - OOG6_101186
Panther 1 1.100 - - O PTHR12081
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X977
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.