DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and E2f2

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:XP_003750109.1 Gene:E2f2 / 684111 RGDID:1593939 Length:442 Species:Rattus norvegicus


Alignment Length:311 Identity:108/311 - (34%)
Similarity:155/311 - (49%) Gaps:62/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 RHDADAELDEDVVERVAKPASHHPFSLSTPQQQL-----AASVASSSSSGDRNRADTSLGILTKK 265
            |..|..:||.:.:.|...|      ...||:.:.     ..|..:..|.|::.|.|||||:||||
  Rat    84 RLPAKRKLDLEGLGRPTVP------EFRTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKK 142

  Fly   266 FVDLLQESPDGVVDLNEASNRLHVQKRRIYDITNVLEGINILEKKSKNNIQWRCGQSMV------ 324
            |:.||.||.|||:|||.|:..|.||||||||||||||||.::.||||||||| .|:.:.      
  Rat   143 FIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKSKNNIQW-VGRGIFEDPTRP 206

  Fly   325 --SQERSRHIEADSLRLEQQENELNKAIDLMRENLAEISQEVENSG-GMAYVTQNDLLNVDLFKD 386
              .|:..:.:: :.:..||..::|.::..|..::|.|     :|:. .:||||..|:..|..||:
  Rat   207 AKEQQLGQELK-ELMNAEQTLDQLIQSCTLSFKHLTE-----DNANKKLAYVTYQDIRAVGNFKE 265

  Fly   387 QIVIVIKAPPEAKLVRSATALKFQPLPFNLNLPNTKLPREIYVKAENSGEINVFLC--------- 442
            |.||.:||||:.:|.....|.:        ||       :||:|: ..|.|.|:||         
  Rat   266 QTVIAVKAPPQTRLEVPDRAEE--------NL-------QIYLKS-TQGPIEVYLCPEEGQEADS 314

  Fly   443 --HDTSPENSPIAPGAGYVGAPG----AGCVRTATSTRLHPLTNQRLNDPL 487
              .:..|..|.::| ......||    :|...|..|:.|.|   |.:..||
  Rat   315 PTKEALPSTSTLSP-VPDCAQPGCSTDSGLAETIESSVLMP---QPVPPPL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 46/61 (75%)
E2F_DD 327..444 CDD:304549 34/128 (27%)
coiled coil 327..362 CDD:271137 6/34 (18%)
E2f2XP_003750109.1 E2F_TDP 133..196 CDD:280479 47/63 (75%)
E2F_DD 207..308 CDD:271137 35/122 (29%)
coiled coil 207..242 CDD:271137 6/35 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351854
Domainoid 1 1.000 101 1.000 Domainoid score I6766
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4037
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - otm46224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12081
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X977
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.