DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and e2f5

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_001184229.1 Gene:e2f5 / 402908 ZFINID:ZDB-GENE-030828-3 Length:363 Species:Danio rerio


Alignment Length:390 Identity:109/390 - (27%)
Similarity:173/390 - (44%) Gaps:119/390 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 AASVASSSSSGDRNRADTSLGILTKKFVDLLQESPDGVVDLNEASNRLHV-QKRRIYDITNVLEG 303
            :||...|:.:|. :|.:.|||:||.|||.||||:.|||:||..|::.|.| ||||||||||||||
Zfish     6 SASFPHSTPNGS-SRHEKSLGLLTVKFVTLLQEAKDGVLDLKVAADSLAVKQKRRIYDITNVLEG 69

  Fly   304 INILEKKSKNNIQWRCGQSMVSQ-----ERSRHIEADSLRLEQQENELNKAIDLMRENLAEISQE 363
            |.::|||:||.|||: |:|...|     |:...::|:...||.||.||:.....:::::.:::::
Zfish    70 IGLIEKKTKNTIQWK-GESTGCQPQEVLEQVELLKANIADLELQERELDMQKACLQQSIKQLNED 133

  Fly   364 VENSGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKLVRSATALKFQPLP---------FNLNLP 419
             ..|...:||...|:  .|.|....::.:.||       |.|.|:. |:|         :.:|| 
Zfish   134 -PYSCRYSYVMHEDI--CDAFSGDTLLAVMAP-------SGTQLEV-PVPEMGHNGQKKYQVNL- 186

  Fly   420 NTKLPREIYVKAENSGEINVFLCHDTSPENSPIAPGAGYVGAPGAGCVRTATSTRLHPLTNQRLN 484
                       ..:|..|.|.|.:..:..:.|:.                             ::
Zfish   187 -----------RSHSAPIQVMLINRETSCSKPVV-----------------------------VS 211

  Fly   485 DPLFNNIDAMST-----KGLFQTPYRSARNLSKSIEEAAKQSQPEYNNICDIAMGQHHNLNQQQQ 544
            .|..::|.:|.|     .||.:.|..|.                   ::||              
Zfish   212 VPPIDDISSMPTPPSTPAGLQRFPISSI-------------------DLCD-------------- 243

  Fly   545 QQQQQLLQQPEEDDVDVELNQLVPTLTNPVVRTHQFQQHQQPSIQELFSSLTESSPPTPTKRRRE 609
             |:..||:.|..:      :||.|:.|:|.|  |.....:.|:.|.|   |.:||...|.:::||
Zfish   244 -QKHGLLKSPAAE------HQLTPSSTSPDV--HMECNPESPASQCL---LMQSSLGGPEEQQRE 296

  Fly   610  609
            Zfish   297  296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 42/62 (68%)
E2F_DD 327..444 CDD:304549 27/125 (22%)
coiled coil 327..362 CDD:271137 8/34 (24%)
e2f5NP_001184229.1 E2F_TDP 21..85 CDD:280479 43/64 (67%)
COG5665 74..>328 CDD:227952 69/321 (21%)
E2F_DD 97..201 CDD:271137 27/126 (21%)
coiled coil 97..132 CDD:271137 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101186
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3254
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.