DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and E2f6

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_001094187.1 Gene:E2f6 / 313978 RGDID:631412 Length:272 Species:Rattus norvegicus


Alignment Length:214 Identity:75/214 - (35%)
Similarity:122/214 - (57%) Gaps:30/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 RNRADTSLGILTKKFVDLLQESPDGVVDLNEASNRLHVQKRRIYDITNVLEGINILEKKSKNNIQ 316
            |.|.|.||..||:||:||::.:|.|::|||:.:.:|.|:|||:|||||||:||.::||||||:|:
  Rat    61 RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIELVEKKSKNHIR 125

  Fly   317 WRCGQSM---VSQERSRHIEADSLRLEQQENELNKAIDLMRENLAEISQEVENSGGMAYVTQNDL 378
            | .|..:   .:..:.:.::|:...|...|:.|::.|....:.|.|::.:.||. .:||||..|:
  Rat   126 W-IGSDLNNFGAAPQQKKLQAELSDLSAMEDALDELIKDCAQQLLELTDDKENE-RLAYVTYQDI 188

  Fly   379 LNVDLFKDQIVIVIKAPPEAKLVRSATALKFQPLPFNLNLPNTKLPRE----IYVKAENSGEINV 439
            ..:..|.:||||.:|||.|.:|                   :...|||    ::::: ..|.|:|
  Rat   189 HGIQAFHEQIVIAVKAPEETRL-------------------DVPAPREDSITVHIRS-TKGPIDV 233

  Fly   440 FLCH-DTSPENSPIAPGAG 457
            :||. :.:..|...|.|.|
  Rat   234 YLCEVEQNHSNGKTADGVG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 35/61 (57%)
E2F_DD 327..444 CDD:304549 32/121 (26%)
coiled coil 327..362 CDD:271137 7/34 (21%)
E2f6NP_001094187.1 E2F_TDP 65..128 CDD:280479 36/63 (57%)
E2F_DD 139..239 CDD:271137 32/120 (27%)
coiled coil 139..173 CDD:271137 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10380
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - otm46224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12081
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.