DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and E2f3

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_001131098.2 Gene:E2f3 / 291105 RGDID:1561600 Length:458 Species:Rattus norvegicus


Alignment Length:299 Identity:103/299 - (34%)
Similarity:162/299 - (54%) Gaps:52/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SHHPF---SLSTPQQQLAASVAS------SSSSGDRNRADTSLGILTKKFVDLLQESPDGVVDLN 281
            |.|.:   .|.||:.:..|::.|      ..|..::.|.|||||:|||||:.||.:|||||:|||
  Rat   134 SGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLN 198

  Fly   282 EASNRLHVQKRRIYDITNVLEGINILEKKSKNNIQWR-CGQS----MVSQERSRHIEADSLRLEQ 341
            :|:..|.||||||||||||||||::::||||||:||. |..|    |::|  .:.:..:...|.|
  Rat   199 KAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQ--CQGLSKEVTELSQ 261

  Fly   342 QENELNKAIDLMRENLAEISQEVENSGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKLVRSATA 406
            :|.:|::.|.....:|..::::.||. .:||||..|:..:...|||.|||:|||||.:       
  Rat   262 EEKKLDELIQSCTLDLKLLTEDSENQ-RLAYVTYQDIRKISGLKDQTVIVVKAPPETR------- 318

  Fly   407 LKFQPLPFNLNLPNTKLPREIYVKAENSGEINVFLCHDTSPENSPI------------APGAGYV 459
                     |.:|::....:|:: |...|.|.|:||.:.:..:.|:            .|.:..:
  Rat   319 ---------LEVPDSIESLQIHL-ASTQGPIEVYLCPEETETHRPMKTNNQDHNGNIPKPTSKDL 373

  Fly   460 GAPGAGCVRTATST-RLHPLTN-----QRLNDPLFNNID 492
            .:..:|....:.|| .|.||.:     |:..|.:.:|::
  Rat   374 ASNNSGHSDCSVSTANLSPLASPANLLQQTEDQIPSNLE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 45/61 (74%)
E2F_DD 327..444 CDD:304549 33/116 (28%)
coiled coil 327..362 CDD:271137 6/34 (18%)
E2f3NP_001131098.2 E2F_TDP 173..236 CDD:396755 46/62 (74%)
E2F_DD 247..347 CDD:271137 34/119 (29%)
coiled coil 247..282 CDD:271137 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6766
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4037
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - otm46224
orthoMCL 1 0.900 - - OOG6_101186
Panther 1 1.100 - - O PTHR12081
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X977
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.