DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and E2F1

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_005216.1 Gene:E2F1 / 1869 HGNCID:3113 Length:437 Species:Homo sapiens


Alignment Length:403 Identity:113/403 - (28%)
Similarity:177/403 - (43%) Gaps:102/403 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 VAKPASHHPFSLSTPQQQLAASVASS-----------SSSGDRNRADTSLGILTKKFVDLLQESP 274
            :.:|.......|.|..|.||.|...:           .|.|:::|.:|||.:.||:|::||..|.
Human    83 LGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSA 147

  Fly   275 DGVVDLNEASNRLHVQKRRIYDITNVLEGINILEKKSKNNIQWRCGQSMVS-QERSRHIEADSLR 338
            |||||||.|:..|.||||||||||||||||.::.|||||:|||....:.|. ..|...:..|..:
Human   148 DGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQ 212

  Fly   339 LEQQENELNKAIDLMRENLAEISQEVENSGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKLVRS 403
            |::.|.:|:..:::....|..:|::.: |..:||||..||.::....:|:|:|||||||.:|...
Human   213 LQESEQQLDHLMNICTTQLRLLSEDTD-SQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAV 276

  Fly   404 ATALKFQPLPFNLNLPNTKLPREIYVKAENSGEINVFLCHDTSPENS--PIAPGAGYVGAPGAGC 466
            .::..||                |.:|:: .|.|:||||    ||.:  .|:||           
Human   277 DSSENFQ----------------ISLKSK-QGPIDVFLC----PEETVGGISPG----------- 309

  Fly   467 VRTATSTRLHPLTNQRLNDPLFNNIDAMSTKGLFQTPYRSARNLSKSIEEAAKQSQPEYNNICDI 531
                 .|....:|::..|                           ::.:.|...|.|..:....:
Human   310 -----KTPSQEVTSEEEN---------------------------RATDSATIVSPPPSSPPSSL 342

  Fly   532 AMGQHHNLNQQQQQ---QQQQLLQQPEEDDVDVELNQLVPTLTNPVVRTHQFQQHQQPSIQELFS 593
            ......:|...:|:   .:...|:.|.::|           ..:|:|......:|    ::|.||
Human   343 TTDPSQSLLSLEQEPLLSRMGSLRAPVDED-----------RLSPLVAADSLLEH----VREDFS 392

  Fly   594 SLTES-----SPP 601
            .|...     |||
Human   393 GLLPEEFISLSPP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 41/61 (67%)
E2F_DD 327..444 CDD:304549 34/116 (29%)
coiled coil 327..362 CDD:271137 6/34 (18%)
E2F1NP_005216.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..87 0/3 (0%)
Cyclin A:CDK2 binding. /evidence=ECO:0000269|PubMed:8033208 67..108 7/24 (29%)
Interaction with BIRC2/c-IAP1. /evidence=ECO:0000269|PubMed:21653699 89..191 50/101 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..128 5/26 (19%)
E2F_TDP 129..192 CDD:280479 42/62 (68%)
Leucine-zipper 153..174 15/20 (75%)
DEF box 158..194 25/35 (71%)
Required for interaction with TRIM28. /evidence=ECO:0000269|PubMed:17704056 192..382 53/265 (20%)
Dimerization. /evidence=ECO:0000255 195..284 27/105 (26%)
E2F_DD 202..301 CDD:271137 35/120 (29%)
coiled coil 202..236 CDD:271137 6/33 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..349 10/91 (11%)
Transactivation 368..437 12/53 (23%)
RB1 binding. /evidence=ECO:0000269|PubMed:12598654 409..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10661
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - otm42079
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12081
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3254
SonicParanoid 1 1.000 - - X977
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.