DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and F46B6.10

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_505529.1 Gene:F46B6.10 / 185841 WormBaseID:WBGene00009775 Length:127 Species:Caenorhabditis elegans


Alignment Length:85 Identity:19/85 - (22%)
Similarity:27/85 - (31%) Gaps:18/85 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 QLRHDADAELDEDVVERVAKPASHHPFSLSTPQQQLAASVASSSSSGDRNRADTSLGILTKKFVD 268
            :|:.|..|.| |:|..|...|         .||....:.:......|.........|:.:.|   
 Worm    24 KLKKDKKATL-EEVTPRGTTP---------LPQCSRQSRIVDRDDRGSTKTKGGRRGVKSSK--- 75

  Fly   269 LLQESPDGVVD-LNEASNRL 287
                .||...| ..|.:.||
 Worm    76 ----EPDSTDDAFKEMAKRL 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 8/33 (24%)
E2F_DD 327..444 CDD:304549
coiled coil 327..362 CDD:271137
F46B6.10NP_505529.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.