DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and efl-1

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_507289.1 Gene:efl-1 / 180133 WormBaseID:WBGene00001161 Length:342 Species:Caenorhabditis elegans


Alignment Length:193 Identity:64/193 - (33%)
Similarity:103/193 - (53%) Gaps:44/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 HQLRHDADAELDEDVVERVAKPASHHPFSLSTPQQQLAASVASSSSSGDRNRADTSLGILTKKFV 267
            ::|..|.|.:.|||               |..||.              ..|||.|||:|.|:|:
 Worm    43 NELDFDFDFDEDED---------------LDQPQM--------------GTRADKSLGLLAKRFI 78

  Fly   268 DLLQESPDGVVDLNEASNRLHV-QKRRIYDITNVLEGINILEKKSKNNIQWRCGQSMVS------ 325
            .::|.||.|..|||.|:..|:| |||||||||||||||.::||:|||.|||:.|..|::      
 Worm    79 RMIQYSPYGRCDLNTAAEALNVRQKRRIYDITNVLEGIGLIEKRSKNMIQWKGGDFMLNVKEGKR 143

  Fly   326 -------QERSRHIEADSLRLEQQENELNKAIDLMRENLAEISQEVENSGGMAYVTQNDLLNV 381
                   ::|...::|:..:|.::|..:.:....::::|..:::.|||: .::||.::.|..:
 Worm   144 QSATTEEEDRMEQLKAEIEQLNKEEELIEQRQRWLQQSLRNMTESVENN-KLSYVLRSQLAEI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 39/62 (63%)
E2F_DD 327..444 CDD:304549 11/55 (20%)
coiled coil 327..362 CDD:271137 5/34 (15%)
efl-1NP_507289.1 E2F_TDP 67..131 CDD:367033 40/63 (63%)
coiled coil 152..187 CDD:271137 5/34 (15%)
E2F_CC-MB 157..254 CDD:374536 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I5541
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - oto19305
orthoMCL 1 0.900 - - OOG6_101186
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3254
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.