DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and E2f5

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_031918.2 Gene:E2f5 / 13559 MGIID:105091 Length:335 Species:Mus musculus


Alignment Length:397 Identity:110/397 - (27%)
Similarity:180/397 - (45%) Gaps:112/397 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 AKPASHHPFSLSTPQQQLAASVASSSSSGDRNRADTSLGILTKKFVDLLQESPDGVVDLNEASNR 286
            |:|..|     ..|..|.:|::|..||     |.:.|||:||.|||.||||:.|||:||..|::.
Mouse    18 AQPPPH-----GAPSSQPSAALAGGSS-----RHEKSLGLLTTKFVSLLQEAQDGVLDLKAAADT 72

  Fly   287 LHV-QKRRIYDITNVLEGINILEKKSKNNIQWR-----CGQSMVSQERSRHIEADSLRLEQQENE 345
            |.| |||||||||||||||:::||||||:|||:     |....|. :|.|.::|:...||.:|.|
Mouse    73 LAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVI-DRLRCLKAEIEDLELKERE 136

  Fly   346 LNKAIDLMRENLAEISQEVENSGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKLVRSATALKFQ 410
            |::....:::::..:.::..|: ..:|||..|:.|  .|....::.|:||       |.|.|:. 
Mouse   137 LDQQKLWLQQSIKNVMEDSINN-RFSYVTHEDICN--CFHGDTLLAIQAP-------SGTQLEV- 190

  Fly   411 PLP---------FNLNLPNTKLPREIYVKAENSGEINVFLCHDTSPENSPI---APGAGYVGAPG 463
            |:|         :.:||.:            :||.|:|.|.:..|..:.|:   .|....:..|.
Mouse   191 PIPEMGQNGQKKYQINLKS------------HSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPS 243

  Fly   464 AGCVRTATSTRLHPLTNQRLNDPLFNNIDAMSTKGLFQTPYRSARNLSKSIEEAAKQSQPEYNNI 528
            :   :::||.                            ||.:|.         .|.|:.||    
Mouse   244 S---QSSTSV----------------------------TPQKST---------MAAQNLPE---- 264

  Fly   529 CDIAMGQHHNLNQQQQQQQQQLLQQPEEDDVDVE-LNQLVPTLTNPVVR-------THQFQQHQQ 585
                  ||  ::::.|..||....:.....:..: :::|:.:...|::|       .:.|.....
Mouse   265 ------QH--VSERSQTFQQTPAAEVSSGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDN 321

  Fly   586 PSIQELF 592
            ..:.:||
Mouse   322 EGVCDLF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 43/62 (69%)
E2F_DD 327..444 CDD:304549 30/125 (24%)
coiled coil 327..362 CDD:271137 8/34 (24%)
E2f5NP_031918.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 9/31 (29%)
Gly-rich_Ago1 <7..60 CDD:289530 22/51 (43%)
E2F_TDP 42..106 CDD:280479 44/63 (70%)
Leucine-zipper 66..88 14/21 (67%)
DEF box 71..108 26/36 (72%)
Dimerization. /evidence=ECO:0000255 109..205 25/107 (23%)
E2F_DD 118..222 CDD:271137 30/126 (24%)
coiled coil 118..153 CDD:271137 8/34 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..285 17/110 (15%)
Transactivation. /evidence=ECO:0000255 277..335 6/52 (12%)
RBL2 association. /evidence=ECO:0000255 312..329 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4343
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101186
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.