DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and E2f3

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:XP_011242577.1 Gene:E2f3 / 13557 MGIID:1096340 Length:467 Species:Mus musculus


Alignment Length:299 Identity:103/299 - (34%)
Similarity:162/299 - (54%) Gaps:52/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SHHPF---SLSTPQQQLAASVAS------SSSSGDRNRADTSLGILTKKFVDLLQESPDGVVDLN 281
            |.|.:   .|.||:.:..|::.|      ..|..::.|.|||||:|||||:.||.:|||||:|||
Mouse   143 SGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLN 207

  Fly   282 EASNRLHVQKRRIYDITNVLEGINILEKKSKNNIQWR-CGQS----MVSQERSRHIEADSLRLEQ 341
            :|:..|.||||||||||||||||::::||||||:||. |..|    |::|  .:.:..:...|.|
Mouse   208 KAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQ--CQGLSKEVTELSQ 270

  Fly   342 QENELNKAIDLMRENLAEISQEVENSGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKLVRSATA 406
            :|.:|::.|.....:|..::::.||. .:||||..|:..:...|||.|||:|||||.:       
Mouse   271 EEKKLDELIQSCTLDLKLLTEDSENQ-RLAYVTYQDIRKISGLKDQTVIVVKAPPETR------- 327

  Fly   407 LKFQPLPFNLNLPNTKLPREIYVKAENSGEINVFLCHDTSPENSPI------------APGAGYV 459
                     |.:|::....:|:: |...|.|.|:||.:.:..:.|:            .|.:..:
Mouse   328 ---------LEVPDSIESLQIHL-ASTQGPIEVYLCPEETETHRPMKTNNQDHNGNIPKPTSKDL 382

  Fly   460 GAPGAGCVRTATST-RLHPLTN-----QRLNDPLFNNID 492
            .:..:|....:.|| .|.||.:     |:..|.:.:|::
Mouse   383 ASNNSGHSDCSVSTANLSPLASPANLLQQTEDQIPSNLE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 45/61 (74%)
E2F_DD 327..444 CDD:304549 33/116 (28%)
coiled coil 327..362 CDD:271137 6/34 (18%)
E2f3XP_011242577.1 E2F_TDP 181..245 CDD:367033 46/63 (73%)
E2F_DD 256..356 CDD:271137 34/119 (29%)
coiled coil 256..291 CDD:271137 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6922
eggNOG 1 0.900 - - E1_KOG2577
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - otm44132
orthoMCL 1 0.900 - - OOG6_101186
Panther 1 1.100 - - O PTHR12081
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3254
SonicParanoid 1 1.000 - - X977
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.