DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and E2f5

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:XP_038959509.1 Gene:E2f5 / 116651 RGDID:621357 Length:338 Species:Rattus norvegicus


Alignment Length:256 Identity:88/256 - (34%)
Similarity:138/256 - (53%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 AKPASHHPFSLSTPQQQ----------LAASVASSSSSGDRNRADTSLGILTKKFVDLLQESPDG 276
            |:|.|.   :..|||.|          ..:|..|::.:|..:|.:.|||:||.|||.||||:.||
  Rat     4 AEPTSS---AQPTPQAQAQPPPPPPHGAPSSHQSAALAGGSSRHEKSLGLLTTKFVSLLQEAQDG 65

  Fly   277 VVDLNEASNRLHV-QKRRIYDITNVLEGINILEKKSKNNIQWR-----CGQSMVSQERSRHIEAD 335
            |:||..|::.|.| |||||||||||||||:::||||||:|||:     |....|. :|.|.::|:
  Rat    66 VLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVI-DRLRCLKAE 129

  Fly   336 SLRLEQQENELNKAIDLMRENLAEISQEVENSGGMAYVTQNDLLNVDLFKDQIVIVIKAPPEAKL 400
            ...||.:|.||::....:::::..:.::..|: ..:|||..|:.:  .|....::.|:||     
  Rat   130 IEDLELKERELDQQKLWLQQSIKNVMEDSINN-RFSYVTHEDICS--CFNGDTLLAIQAP----- 186

  Fly   401 VRSATALKFQPLP---------FNLNLPNTKLPREIYVKAENSGEINVFLCHDTSPENSPI 452
              |.|.|:. |:|         :.:||.:            :||.|:|.|.:..|..:.|:
  Rat   187 --SGTQLEV-PIPEMGQNGQKKYQINLKS------------HSGPIHVLLINKESNSSKPV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 43/62 (69%)
E2F_DD 327..444 CDD:304549 29/125 (23%)
coiled coil 327..362 CDD:271137 8/34 (24%)
E2f5XP_038959509.1 E2F_TDP 45..109 CDD:396755 44/63 (70%)
E2F_DD 121..225 CDD:271137 29/126 (23%)
coiled coil 121..156 CDD:271137 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101186
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.