DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and e2f6

DIOPT Version :9

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:XP_002942229.1 Gene:e2f6 / 100494302 XenbaseID:XB-GENE-482439 Length:257 Species:Xenopus tropicalis


Alignment Length:201 Identity:73/201 - (36%)
Similarity:120/201 - (59%) Gaps:34/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 RNRADTSLGILTKKFVDLLQESPDGVVDLNEASNRLHVQKRRIYDITNVLEGINILEKKSKNNIQ 316
            |.|.|.||..||:||||:::.:|:||||||:.:|.|.|:|||:|||||||:|||:::|:|||::|
 Frog    50 RPRFDVSLFYLTRKFVDIIKAAPEGVVDLNDVANTLGVRKRRVYDITNVLDGINLIQKRSKNHVQ 114

  Fly   317 W------RCGQSMVSQERSRHIEADSLRLEQQENELNKAIDLMRENLAEISQEVENSGGMAYVTQ 375
            |      ..|..:..:::.|:..:|...:|:..::|.|  |...: |.:::::..|. .|||||.
 Frog   115 WMGSDLNHSGTKIPEEQKLRNDISDLTAMEEALDDLIK--DCAHQ-LFKLTEDRANR-KMAYVTY 175

  Fly   376 NDLLNVDLFKDQIVIVIKAPPEAKLVRSATALKFQPLPFNLNLPNTKLPR----EIYVKAENSGE 436
            .|:.:::.:.:||||.:|:|.|.||                   ....|:    ||::|: ..|.
 Frog   176 QDIHSIEEYHEQIVIAVKSPEETKL-------------------EVPAPKEDCIEIHIKS-TKGP 220

  Fly   437 INVFLC 442
            |:|:||
 Frog   221 IDVYLC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:280479 38/67 (57%)
E2F_DD 327..444 CDD:304549 32/120 (27%)
coiled coil 327..362 CDD:271137 7/34 (21%)
e2f6XP_002942229.1 E2F_TDP 53..117 CDD:367033 38/63 (60%)
E2F_DD 129..229 CDD:271137 32/122 (26%)
coiled coil 129..163 CDD:271137 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10946
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000356
OrthoInspector 1 1.000 - - otm49309
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.