DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment InR and RK2

DIOPT Version :9

Sequence 1:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster
Sequence 2:NP_176756.1 Gene:RK2 / 842891 AraportID:AT1G65800 Length:847 Species:Arabidopsis thaliana


Alignment Length:552 Identity:132/552 - (23%)
Similarity:221/552 - (40%) Gaps:162/552 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1246 KLQKPDQVE------------EKKCIPAADF---------NQTAGYLIKLNEGLYSFRVRANS-- 1287
            |::.||..|            |::|:...:.         |..:|.:| .:.||:..|..|..  
plant   356 KMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTDIRNGGSGCVI-WSGGLFDIRNYAKGGQ 419

  Fly  1288 -----IAGYGDFTEVEHIKVEPPPSYAKVFFWLLG--IGLAFLIVSLFGYVCYLHKRK------- 1338
                 :|. ||. |.:.||.:.          ::|  ||::.|::..| .:.:..|||       
plant   420 DLYVRVAA-GDL-EDKRIKSKK----------IIGSSIGVSILLLLSF-IIFHFWKRKQKRSITI 471

  Fly  1339 -------VPSNDLHMN--TEVNPFYASMQYIPD-------DWEVL---RENIIQLAPLGQGSFGM 1384
                   |.|.|..||  .:.:..|.|.:...|       :|:.|   ..|......||||.||:
plant   472 QTPIVDLVRSQDSLMNELVKASRSYTSKENKTDYLELPLMEWKALAMATNNFSTDNKLGQGGFGI 536

  Fly  1385 VYEGILKSFPPNGVDRECAIKTVNE---NATDRERTNFLSEASVMKEFDTYHVVRLLGVCSRGQP 1446
            ||:|:|..      .:|.|:|.:::   ..||    .|::|..::.:....::|||||.|.....
plant   537 VYKGMLLD------GKEIAVKRLSKMSSQGTD----EFMNEVRLIAKLQHINLVRLLGCCVDKGE 591

  Fly  1447 ALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYL- 1510
            .:::.|.::...|.|:|       .|:...:.||            :.:.:.:...||.|:.|| 
plant   592 KMLIYEYLENLSLDSHL-------FDQTRSSNLN------------WQKRFDIINGIARGLLYLH 637

  Fly  1511 --AAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIY---ETDYYRK---GTKGLLPVRWMPPES 1567
              :..:.:||||.|.|.::..::|.||.||||.| |:   ||:...:   ||.|     :|.||.
plant   638 QDSRCRIIHRDLKASNVLLDKNMTPKISDFGMAR-IFGREETEANTRRVVGTYG-----YMSPEY 696

  Fly  1568 LRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPENCPDFLHKLMQRC 1632
            ..||::|..||||||||:|.|:  ::.:..:|..|.            .|..|...|:       
plant   697 AMDGIFSMKSDVFSFGVLLLEI--ISGKRNKGFYNS------------NRDLNLLGFV------- 740

  Fly  1633 WHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHS-EAGL---QHREKERKERNQL-----DAFA 1688
            |.|....:.  |:|:..:.....:|:|........ :.||   |.|.::|...:.:     ....
plant   741 WRHWKEGKE--LEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGSETT 803

  Fly  1689 AVP-------------LDQDLQDREQQEDATT 1707
            |:|             |:.|.....|::|..|
plant   804 AIPQPKRPGFCVGRSSLEVDSSSSTQRDDECT 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020 18/83 (22%)
PTKc_InsR_like 1364..1652 CDD:173625 83/302 (27%)
Pkinase_Tyr 1371..1650 CDD:285015 80/290 (28%)
RK2NP_176756.1 B_lectin 35..157 CDD:237995
B_lectin 35..156 CDD:214519
S_locus_glycop 216..325 CDD:279321
PAN_2 347..411 CDD:285476 11/55 (20%)
DUF3660 472..513 CDD:289184 8/40 (20%)
STKc_IRAK 529..798 CDD:270968 87/326 (27%)
DUF3403 800..847 CDD:256698 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.