DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment InR and smal

DIOPT Version :9

Sequence 1:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster
Sequence 2:NP_723165.2 Gene:smal / 5740323 FlyBaseID:FBgn0085409 Length:939 Species:Drosophila melanogaster


Alignment Length:345 Identity:80/345 - (23%)
Similarity:118/345 - (34%) Gaps:92/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1674 REKERKERNQLDAFAAVPLDQDLQDREQQEDATTPLRMGDYQQNSSLDQPPESPI-AMVDDQGS- 1736
            |.|..:..|.||||               :.:..|..:|.   |....:|..:.| |.|||..| 
  Fly   526 RTKRARGSNVLDAF---------------QYSFNPNTLGG---NVDKHRPNGNSIKANVDDNDSI 572

  Fly  1737 ------HLPFSLPSGFIASSTPDGQTVMATAFQNIPAAQGDISATYVVPD-ADALDGDRGYEI-- 1792
                  |.||::.              |.|...|..||..|:... :.|| .|..:|  ||.:  
  Fly   573 GKNSLYHEPFNVN--------------MYTCGVNGYAAVNDLQCN-MTPDYTDVPEG--GYAVPH 620

  Fly  1793 ---YDPSPKCAELPTSRSGSTGGGKLSGEQHLLPRK-----GRQPTIMSSSM------------- 1836
               |.||.|..      .|:.|||.....:...|..     .|.||:....|             
  Fly   621 MQDYMPSSKMG------GGAPGGGGYVNVRRTPPPPLSSIFPRPPTVPPPPMEKYYATTAIFKPL 679

  Fly  1837 --PDDVIGGSSLQPSTASAG----SSNASSH--TGRPSLKKTVADSVRNKANFINRHLFNHKRTG 1893
              |.....|.|...:|.|:|    |.:.|||  ||.|.......|.:....:.....:.|...:|
  Fly   680 KGPGSERSGCSSNTNTVSSGGGKSSHSHSSHCSTGGPDHSGIYDDGIGTMNSKATAPMINPYSSG 744

  Fly  1894 SNASHKSNASNAPSTSSNTNLTSHPVAMGNLGTIE---------SGGSGSAGSYT--GTPRFYTP 1947
            :::|..:.|:.....:...|..|:|..: ...:::         :..:.||||.|  ..|:..:.
  Fly   745 NSSSAAAAAAAEFQRARTYNFRSYPDNLXFEASLKLVAAAPKRITAATASAGSTTMPKKPQHLSL 809

  Fly  1948 SATPGGGSGMAISDNPNYRL 1967
            .|:..||.|...|..|.|.|
  Fly   810 VASTAGGYGCGTSSKPKYSL 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020
PTKc_InsR_like 1364..1652 CDD:173625
Pkinase_Tyr 1371..1650 CDD:285015
smalNP_723165.2 FA58C 78..234 CDD:214572
FA58C 81..233 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.